BYKdb

Annotate results for A0A0J5YVE4

A0A0J5YVE4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J5YVE4
DOMAINcd43/223TSSGPGEGKSTTTANLAVVFAQQGKRVLLVDADLRKPTVHYTFNLMNTSGLTSVLTNQMT
LMESVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFMNAALEEFDIILFDTPPVLAVTD
AQILSNKCQGTILVAGSGKAEKEQLVKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGV
N
SITEWalker A50/52GKS
SITEWalker A'70/77LLVDADLR
SITEWalker B150/156ILFDTPP
SITEY Cluster217/220YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEHKRKLVTKNDPKSPISEQYRTIRTNIQFSSVDEEIRTIMVTSSGPGEGKSTTTANLAVVFAQQGKRVLLVDADLRKPT
                                          TSSGPGEGKSTTTANLAVVFAQQGKRVLLVDADLRKPT
                                                 GKS                 LLVDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHYTFNLMNTSGLTSVLTNQMTLMESVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFMNAALEEFDIILFDTPPVLAV
VHYTFNLMNTSGLTSVLTNQMTLMESVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFMNAALEEFDIILFDTPPVLAV
                                                                     ILFDTPP    
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
TDAQILSNKCQGTILVAGSGKAEKEQLVKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGVN
TDAQILSNKCQGTILVAGSGKAEKEQLVKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGVN
                                                        YYYY   
© 1998-2019