BYKdb

Annotate results for A0A0J6CIR2

A0A0J6CIR2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J6CIR2
DOMAINtad8/248NELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSE
SAAFEELNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIA
VRFPEAEASQSFSLVATPLSAGEILLSGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYY
ADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDVSIPRAEDVLNMLIA
V
DOMAINcd582/773TSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGTTNMGITNYLSGKVD
DINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLDALIEELKKRYDYIILDNVPAGLV
ADAAIVNRVADLTIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGY
GYGYGYGYGYGY
SITEWalker A589/591GKT
SITEWalker A'609/616ILVDLDIR
SITEWalker B691/697IILDNVP
SITE-688/-690YDY
SITEY Cluster752/773YNRSGYGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEELNMFNVK
       NELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEELNMFNVK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILLSGFSTNE
SNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILLSGFSTNE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDVSIPRAED
AKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDVSIPRAED

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYSKEGLGLE
VLNMLIAV                                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMKQTIIRAI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVIDAAQGSR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRDSISEAFR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGTTNMGITNYLSGKV
                     TSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGTTNMGITNYLSGKV
                            GKT                 ILVDLDIR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLDALIEELKKRYDYIILDNVPAGLVADAAIVNRVADLTIYILRA
DDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLDALIEELKKRYDYIILDNVPAGLVADAAIVNRVADLTIYILRA
                                                  IILDNVP                       
       730       740       750       760       770         
....:....|....:....|....:....|....:....|....:....|....:....
GLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGYGNEKKK
GLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGY      
                               YNRSGYGYGYGYGYGYGYGYGY      

© 1998-2019