BYKdb

Annotate results for A0A0J6CKW3

A0A0J6CKW3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J6CKW3
DOMAINtad15/265NELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAAS
EAAVFEDLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPV
VVRFPEANENLEFGLTVVPVSDKEVSLSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIG
KVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTATILNLSLQDVSASR
AEDVLNTLIAI
DOMAINcd599/789TSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSARISHAGAGLTHYLSGRVDD
VDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVA
DATIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKLEKFRNMAVILNGINMKRAGYGYGYG
YGYGYGYGYGN
SITEWalker A606/608GKT
SITEWalker A'626/633ILVDTDIR
SITEWalker B707/713VILDNVP
SITE-704/-706YDY
SITEY Cluster773/787YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNPEQETNMLREEENELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
              NELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANENLEFGLTVVPVSDKEVS
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANENLEFGLTVVPVSDKEVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA
LSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKRENQLTDIHSEAG
TILNLSLQDVSASRAEDVLNTLIAI                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDVSLESQISEYNTLLLKRDKLIGNSSNRNPVVM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREVQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMVVPSGILWVQLTMNTTVRSRKDIEDNLSVPFLGEIPSRNRKDKS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
                                      TSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
                                             GKT                 ILVDTDIR       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
                                                                  VILDNVP       
       730       740       750       760       770       780       790       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKLEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGYGNEKSQKHKK
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKLEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGYGN        
                                                    YGYGYGYGYGYGYGY          

© 1998-2019