BYKdb

Annotate results for A0A0J6CWX1

A0A0J6CWX1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6CWX1
DOMAINcd43/223TSPMAGEGKTTTITNLAVVMAQQEKKVLIIDADTRKPSVHYAFQRNNIKGVTNVLTGQLS
LKGAVIPTAVPNLDILASGPIPPNPSELLASPQMEQLLKEACRHYDIVLVDTPPVLIVSD
AQIMANRCQGSILVVNSGKTESDSANQAKDALIHAKAKLLGVVLNRKNKRRDKTFYYYGR
Q
SITE-180/-182GKT
SITEWalker A'70/77LIIDADTR
SITEWalker B150/156VLVDTPP
SITEY Cluster218/220YYY
SITEWalker A50/52GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKRNQMLVTHLNPKSPVAEQYRTIRTNIQFASINEQIQTYMVTSPMAGEGKTTTITNLAVVMAQQEKKVLIIDADTRKPS
                                          TSPMAGEGKTTTITNLAVVMAQQEKKVLIIDADTRKPS
                                                 GKT                 LIIDADTR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHYAFQRNNIKGVTNVLTGQLSLKGAVIPTAVPNLDILASGPIPPNPSELLASPQMEQLLKEACRHYDIVLVDTPPVLIV
VHYAFQRNNIKGVTNVLTGQLSLKGAVIPTAVPNLDILASGPIPPNPSELLASPQMEQLLKEACRHYDIVLVDTPPVLIV
                                                                     VLVDTPP    
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
SDAQIMANRCQGSILVVNSGKTESDSANQAKDALIHAKAKLLGVVLNRKNKRRDKTFYYYGRQ
SDAQIMANRCQGSILVVNSGKTESDSANQAKDALIHAKAKLLGVVLNRKNKRRDKTFYYYGRQ
                                                         YYY   
© 1998-2019