BYKdb

Annotate results for A0A0J6DDB5

A0A0J6DDB5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J6DDB5
DOMAINtad1/135MTLHDAVLAVRKHWLWVLAPILVLTLGIGYLSERAEPVYRARTALFVALTVGDSASDLNQ
GSNYTQAQMLSFAELASLPIVLDPVVEELGLTTSARALAGSISATTLNGTSILNIAVTNP
SPQVAADIANAVAGE
DOMAINcd267/454SSAVEGEGKTHTNLRLAFSLAAAGDRVLVIDADLRRPAVADRLGLEGAAGLTECLVGRAE
FDEVVQHLGDGPSILASGATPPNPGELLASKEFAALLEQVADEYDAVFIDTPPLLPVADA
VVVSRQVAGLILVVDAHKARRPQLTRAVDAVHRGGGRVVGAVLNRSRTAQEESYVYGSPS
RRTRRWPR
SITEWalker A274/276GKT
SITEWalker A'294/301LVIDADLR
SITEWalker B373/379VFIDTPP
SITEY Cluster440/442YVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLHDAVLAVRKHWLWVLAPILVLTLGIGYLSERAEPVYRARTALFVALTVGDSASDLNQGSNYTQAQMLSFAELASLPI
MTLHDAVLAVRKHWLWVLAPILVLTLGIGYLSERAEPVYRARTALFVALTVGDSASDLNQGSNYTQAQMLSFAELASLPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVVEELGLTTSARALAGSISATTLNGTSILNIAVTNPSPQVAADIANAVAGELTTVIAQVAPTTTEGTASIRATIVD
VLDPVVEELGLTTSARALAGSISATTLNGTSILNIAVTNPSPQVAADIANAVAGE                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAVAPKRPASPNVERNVIAAALAGLILGLAAAYVRQAFDTRVRRPEELEAAIDVPLLGVVRGVRRSELEVRVGDAVLNGP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAEEFRRLRTNLQMVGERGAPRMFAVSSAVEGEGKTHTNLRLAFSLAAAGDRVLVIDADLRRPAVADRLGLEGAAGLTEC
                          SSAVEGEGKTHTNLRLAFSLAAAGDRVLVIDADLRRPAVADRLGLEGAAGLTEC
                                 GKT                 LVIDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVGRAEFDEVVQHLGDGPSILASGATPPNPGELLASKEFAALLEQVADEYDAVFIDTPPLLPVADAVVVSRQVAGLILVV
LVGRAEFDEVVQHLGDGPSILASGATPPNPGELLASKEFAALLEQVADEYDAVFIDTPPLLPVADAVVVSRQVAGLILVV
                                                    VFIDTPP                     
       410       420       430       440       450       460       470 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAHKARRPQLTRAVDAVHRGGGRVVGAVLNRSRTAQEESYVYGSPSRRTRRWPRSERVDGAHTRAKAGQTG
DAHKARRPQLTRAVDAVHRGGGRVVGAVLNRSRTAQEESYVYGSPSRRTRRWPR                 
                                       YVY                             
© 1998-2019