BYKdb

Annotate results for A0A0J6ENT9

A0A0J6ENT9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6ENT9
DOMAINcd54/230TSGLPGEGKSFTAANLAVVFSQQEKKVLLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTH
LENVVQQSQTESLHVLTSGPIPPNPAELLSSQAMADLLKEAYEQYDLVLLDSPPLLPVAD
AQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
SITE-191/-193GKT
SITEWalker A'81/88LLIDADLR
SITEWalker B161/167VLLDSPP
SITE-155/-158YEQY
SITEY Cluster228/230YNY
SITEWalker A61/63GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRLAIRKKRSRKYESALVALDQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKV
                                                     TSGLPGEGKSFTAANLAVVFSQQEKKV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQTESLHVLTSGPIPPNPAELLSSQAMADLLKEAYEQYDL
LLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQTESLHVLTSGPIPPNPAELLSSQAMADLLKEAYEQYDL
LLIDADLR                                                                        
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLDSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
VLLDSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
VLLDSPP                                                            YNY
© 1998-2019