BYKdb

Annotate results for A0A0J6LCC9

A0A0J6LCC9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6LCC9
DOMAINcd50/229TSANQSEGKTTTAANIATVFAQQGKKVLLIDADLRKPALHQMMQVDNIFGLTSVLTRSKT
LETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFDTSPILPVTD
AQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYSSN
SITEWalker A57/59GKT
SITEWalker A'77/84LLIDADLR
SITEWalker B157/163VIFDTSP
SITE-151/-154YGTY
SITEY Cluster223/226YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIATVFAQQGKKVLLID
                                                 TSANQSEGKTTTAANIATVFAQQGKKVLLID
                                                        GKT                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
ADLR                                                                        VIFD
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYSSN
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYSSN
TSP                                                           YYYY   
© 1998-2019