BYKdb

Annotate results for A0A0J6WEP7

A0A0J6WEP7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J6WEP7
DOMAINtad1/135MSIQDFFKLLRARWMIVCAATVVAVLGAVVLSLMTTPLYQASTRLFVSTTSGSSLSDIYQ
GNRLSQERVVSYAQLLTGVTLAQRTIDKLGLDMDASELQENISASAKPETVLIDVSVLDK
SPVRARDIANTLSDE
DOMAINcd267/454TSSMPHEGKSTTAINIALALAESERSVLLIDGDMRRPTLAKYMDLVGTVGFSTVLSGAAS
VEDSLQKTRFPGLTVLTSGAIPPNPSELLGSQSARKLLTELRSKFDYVVIDSTPLLAVTD
AAILAAAADGVLIMARFGQAKRDQLAHAVGNLESVGAPLLGAVFTMMPVRGRSSYSYSYT
YYGTDAAQ
SITEWalker A274/276GKS
SITEWalker A'294/301LLIDGDMR
SITEWalker B374/380VVIDSTP
SITEY Cluster441/448YSYSYTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSIQDFFKLLRARWMIVCAATVVAVLGAVVLSLMTTPLYQASTRLFVSTTSGSSLSDIYQGNRLSQERVVSYAQLLTGVT
MSIQDFFKLLRARWMIVCAATVVAVLGAVVLSLMTTPLYQASTRLFVSTTSGSSLSDIYQGNRLSQERVVSYAQLLTGVT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQRTIDKLGLDMDASELQENISASAKPETVLIDVSVLDKSPVRARDIANTLSDEFVAMVRELETPESGAAPDARVVVEQ
LAQRTIDKLGLDMDASELQENISASAKPETVLIDVSVLDKSPVRARDIANTLSDE                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RASLPDKPVVPRIKRNLAVGLALGIVAGVGLAVLRDLLDNTVKSRETLEDITGVGLVGSIPMDKDRRKQPAIAFEGDNSA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPHEGKSTTAINIALALAESERSVLLIDGDMRRPTLAKYMDLVGTVGFSTV
                          TSSMPHEGKSTTAINIALALAESERSVLLIDGDMRRPTLAKYMDLVGTVGFSTV
                                 GKS                 LLIDGDMR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSGAASVEDSLQKTRFPGLTVLTSGAIPPNPSELLGSQSARKLLTELRSKFDYVVIDSTPLLAVTDAAILAAAADGVLIM
LSGAASVEDSLQKTRFPGLTVLTSGAIPPNPSELLGSQSARKLLTELRSKFDYVVIDSTPLLAVTDAAILAAAADGVLIM
                                                     VVIDSTP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARFGQAKRDQLAHAVGNLESVGAPLLGAVFTMMPVRGRSSYSYSYTYYGTDAAQASGRHGGAQSSELSRTSEKADAEAGA
ARFGQAKRDQLAHAVGNLESVGAPLLGAVFTMMPVRGRSSYSYSYTYYGTDAAQ                          
                                        YSYSYTYY                                
       490   
....:....|...
DGAMDATPPKRRQ


© 1998-2019