BYKdb

Annotate results for A0A0J6WM28

A0A0J6WM28 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J6WM28
DOMAINtad1/105MTLVTTPMYQATTRLFVSTTAGNSVTDIYQGNRFSQERVISYTELLMGQTLAQRTVDKLG
LPMTGDQLKSRVKASAKPDTVLIDLAVQDESPVRARDIANTISDE
DOMAINcd237/424TSSVPSEGKSTTAINLALVLAEAEHNVVLVDGDMRRPSLDKYLDLVGTVGFSSVLSGAVS
LDEALQKTRFPGLTVLTSGAIPPNPSELLGSQSARMLLNELRSKFDYVIVDSTPLLAVTD
AAILAAAADGVLIIARHGHTKRDQLAHAVESLQNVGAQPLAAVFSMMPARGSSSYTYQYT
YYGEAPNA
SITEWalker A244/246GKS
SITEWalker A'264/271VLVDGDMR
SITEWalker B344/350VIVDSTP
SITEY Cluster411/418YTYQYTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLVTTPMYQATTRLFVSTTAGNSVTDIYQGNRFSQERVISYTELLMGQTLAQRTVDKLGLPMTGDQLKSRVKASAKPDT
MTLVTTPMYQATTRLFVSTTAGNSVTDIYQGNRFSQERVISYTELLMGQTLAQRTVDKLGLPMTGDQLKSRVKASAKPDT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIDLAVQDESPVRARDIANTISDEFVVMVRELETPENGSTPDARVVVEQRASIPADPVVPRTGMNLMAGLAFGLVLGVG
VLIDLAVQDESPVRARDIANTISDE                                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVLRDLLDNTVKEAKNLEDITGAGVVGTIPLDKERRKTPAIAFESDNSAIAEAFRKLRTNLQFLAVDNPPRVIVITSSV
                                                                            TSSV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSEGKSTTAINLALVLAEAEHNVVLVDGDMRRPSLDKYLDLVGTVGFSSVLSGAVSLDEALQKTRFPGLTVLTSGAIPPN
PSEGKSTTAINLALVLAEAEHNVVLVDGDMRRPSLDKYLDLVGTVGFSSVLSGAVSLDEALQKTRFPGLTVLTSGAIPPN
   GKS                 VLVDGDMR                                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSELLGSQSARMLLNELRSKFDYVIVDSTPLLAVTDAAILAAAADGVLIIARHGHTKRDQLAHAVESLQNVGAQPLAAVF
PSELLGSQSARMLLNELRSKFDYVIVDSTPLLAVTDAAILAAAADGVLIIARHGHTKRDQLAHAVESLQNVGAQPLAAVF
                       VIVDSTP                                                  
       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
SMMPARGSSSYTYQYTYYGEAPNALRAPKKVAAAPPTSKPVPTDGALDTSDAASQSASETETSRSGGRRRRQDD
SMMPARGSSSYTYQYTYYGEAPNA                                                  
          YTYQYTYY                                                        
© 1998-2019