BYKdb

Annotate results for A0A0J6WVZ4

A0A0J6WVZ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6WVZ4
DOMAINcd42/230TSAAPREGKSTTAANMAIMMAQDGKKVLLIDADMRKAVQHIIFNLPNKGLSNCISMNTPF
EEVVQKGIAAPNLDILPGGPMPPNPAELLNSANMAALLRQVRNVYDYIFIDMPPIMVVTD
AAVLASKADRVVLVVRSGVVPPARLQSAKERLEQGGARLLGVILNCVPQYRCDNYGYGAY
YDEKAEKQH
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDADMR
SITEWalker B149/155IFIDMPP
SITE-146/-148YDY
SITEY Cluster211/222YRCDNYGYGAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEINLVTRYKAKSPFAEAYRAVRTNLQFSGAGSAIQCIIFTSAAPREGKSTTAANMAIMMAQDGKKVLLIDADMRKAVQ
                                         TSAAPREGKSTTAANMAIMMAQDGKKVLLIDADMRKAVQ
                                                GKS                 LLIDADMR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HIIFNLPNKGLSNCISMNTPFEEVVQKGIAAPNLDILPGGPMPPNPAELLNSANMAALLRQVRNVYDYIFIDMPPIMVVT
HIIFNLPNKGLSNCISMNTPFEEVVQKGIAAPNLDILPGGPMPPNPAELLNSANMAALLRQVRNVYDYIFIDMPPIMVVT
                                                                    IFIDMPP     
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
DAAVLASKADRVVLVVRSGVVPPARLQSAKERLEQGGARLLGVILNCVPQYRCDNYGYGAYYDEKAEKQHHESAPL
DAAVLASKADRVVLVVRSGVVPPARLQSAKERLEQGGARLLGVILNCVPQYRCDNYGYGAYYDEKAEKQH      
                                                  YRCDNYGYGAYY              
© 1998-2019