BYKdb

Annotate results for A0A0J6WZI1

A0A0J6WZI1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6WZI1
DOMAINcd42/229TSATPAEGKSTTISNVALTMAQDGKKTLLIDADMRKPVQHRIFGIPNQGLSNCIAMDVSW
EETVQHDVVPHLDVLTSGPVPPNPSELLGSERMQKIISQVRTQYDYVLIDMPPVLAVTDA
VVMASRADGVVFVVKSGSISPEEANMAKTKLEQGGAHILGVVLNEVPRRQHGSYGYEYYY
YYDEEHVK
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDADMR
SITEWalker B148/154VLIDMPP
SITE-145/-147YDY
SITEY Cluster215/223YGYEYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEINLIAQYDAKSPIAEAYKAIRTNLQFASVGTAARVITFTSATPAEGKSTTISNVALTMAQDGKKTLLIDADMRKPVQ
                                         TSATPAEGKSTTISNVALTMAQDGKKTLLIDADMRKPVQ
                                                GKS                 LLIDADMR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRIFGIPNQGLSNCIAMDVSWEETVQHDVVPHLDVLTSGPVPPNPSELLGSERMQKIISQVRTQYDYVLIDMPPVLAVTD
HRIFGIPNQGLSNCIAMDVSWEETVQHDVVPHLDVLTSGPVPPNPSELLGSERMQKIISQVRTQYDYVLIDMPPVLAVTD
                                                                   VLIDMPP      
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
AVVMASRADGVVFVVKSGSISPEEANMAKTKLEQGGAHILGVVLNEVPRRQHGSYGYEYYYYYDEEHVKHRNSKKVNN
AVVMASRADGVVFVVKSGSISPEEANMAKTKLEQGGAHILGVVLNEVPRRQHGSYGYEYYYYYDEEHVK         
                                                      YGYEYYYYY               
© 1998-2019