BYKdb

Annotate results for A0A0J6YE86

A0A0J6YE86 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J6YE86
DOMAINcd175/362TSSMPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLSKYLDLMSKVGFSTVLSGAVS
IDDSLQKTRFPGLSVLTSGAVPPNPSELLGSQSARKVLAELRSRFDYVIIDSTPLLAVTD
AAILAAGADGVLIMARFGQTKREQLAHAVGSLESVGAPLLGAVFTMVPTRGTGSYSYNYG
YYGEDEGR
SITEWalker A182/184GKS
SITEWalker A'202/209VLVDGDMR
SITEWalker B282/288VIIDSTP
SITEY Cluster349/356YSYNYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSADELQARITATAKPDTVLIDVAVLDESAVRARDIANTLSDEFVGRVRELETPENSTRADSRVVVEQRASIPSSPVVPK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RARNIAVGLVLGLVLGVGFALIRDLLDNTVKDRTTLEQIANVGLVGTVPLDKERRRHAAIAFENDNSVIAEAFRKLRTNL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFLSVDNPPRVIVITSSMPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLSKYLDLMSKVGFSTVLSGAVSIDDSLQ
              TSSMPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLSKYLDLMSKVGFSTVLSGAVSIDDSLQ
                     GKS                 VLVDGDMR                               
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTRFPGLSVLTSGAVPPNPSELLGSQSARKVLAELRSRFDYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLA
KTRFPGLSVLTSGAVPPNPSELLGSQSARKVLAELRSRFDYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLA
                                         VIIDSTP                                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAVGSLESVGAPLLGAVFTMVPTRGTGSYSYNYGYYGEDEGRRGGNSSTRGGSAESSKTTSANASESRDRSAGDLPARPV
HAVGSLESVGAPLLGAVFTMVPTRGTGSYSYNYGYYGEDEGR                                      
                            YSYNYGYY                                            
        
....:...
TQRRYKTT


© 1998-2019