BYKdb

Annotate results for A0A0J7XGZ1

A0A0J7XGZ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J7XGZ1
DOMAINcd497/685TSPLPREGKSTISMCLARTLAMGKHKVVLVDADVRHHSTSNALAPEREREGLFRVLDGSL
PLEEALIVDERTDLQILTTLGQSGPNDVITEEAVGALLAVLRAHFDIVIIDSAPVLGVAE
TRIVSRLSDTTLVVARWRATPLKAVRTALDLLSHNGSKVGGVALSLVNIKEHASAGLTDA
FGYYKKFKG
SITEWalker A504/506GKS
SITEWalker A'524/531VLVDADVR
SITEWalker B604/610VIIDSAP
SITEY Cluster679/687YYKKFKGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLPRTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLRLDRVPEFGGDSKSPSAKLTPP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATGTDGHGSTGDREQIATINPAERQAAGRLLTHSYVRRVGVTYLVEITASSEDPDLAARIANALARRYIGLDSAKKQAR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAQSAHYVESQAAALRKHAVADDATLQQYMIRNNLMSAEGATMAEQEVSELNRQIADAQAQLAEQRGKLGAAQAQIARGG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGADIGSALASDTIRQLRQQEAQASARLAQLDARYGALHPDVVQARDELADVRAQLGAELGRIVSGLRADVQIAESRLAS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDSRAQAKGSLVQNGSAQVGRLELERRAEASRAIYSAYLTRAKETAQAGELPNADASIATLARPPGGPSSPNYLVGALA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFVAALLVAGLATGMAEYVEDTVATRADIEGGLGAVYAGAIPTLASATRSKAKDMTPQDYVTIRSMSLFTESLRNLATYL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIGHSGSERGAAVVTITSPLPREGKSTISMCLARTLAMGKHKVVLVDADVRHHSTSNALAPEREREGLFRVLDGSLPLEE
                TSPLPREGKSTISMCLARTLAMGKHKVVLVDADVRHHSTSNALAPEREREGLFRVLDGSLPLEE
                       GKS                 VLVDADVR                             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALIVDERTDLQILTTLGQSGPNDVITEEAVGALLAVLRAHFDIVIIDSAPVLGVAETRIVSRLSDTTLVVARWRATPLKA
ALIVDERTDLQILTTLGQSGPNDVITEEAVGALLAVLRAHFDIVIIDSAPVLGVAETRIVSRLSDTTLVVARWRATPLKA
                                           VIIDSAP                              
       650       660       670       680         
....:....|....:....|....:....|....:....|....:....
VRTALDLLSHNGSKVGGVALSLVNIKEHASAGLTDAFGYYKKFKGYYAD
VRTALDLLSHNGSKVGGVALSLVNIKEHASAGLTDAFGYYKKFKG    
                                      YYKKFKGYY  
© 1998-2019