BYKdb

Annotate results for A0A0J7Y2D8

A0A0J7Y2D8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J7Y2D8
DOMAINtad23/192LSAAAQRCWLVLRRHRVILFVTMALCLLAGALFILTSTPDYRATASVEVEDVPAGAAGSA
AAQRAGSANDTETLMQTELEVLRSRALAEEVARDLSLVGTPTFFKGMDEVRPPEGVGTLS
QRQVEQDMVVRLLRDNLEVELPGKSRVLRISFVSADPVLSARVANSYADS
DOMAINcd526/705TSAQEGEGKSLTLHALALALAGLGKSVLVIDGDMRRPVQHRLFRLSPARGISEVLTGQAM
AQDVIVDTGIAGVALLPCGTLPPNPSELLSTPALDGLLTAVRDRYDTVLIDAPPILGIGD
APLLAAKAQASLLVVEWGRNHHGGLRAAVERLRRSGGAIVGAILTKQQGRAMDYDYHRGG
SITE-549/-551GKS
SITEWalker A'553/560LVIDGDMR
SITEWalker B633/639VLIDAPP
SITEY Cluster699/701YDY
SITEWalker A533/535GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLPAFPMRDDADNGGEGFSARLSAAAQRCWLVLRRHRVILFVTMALCLLAGALFILTSTPDYRATASVEVEDVPAGAAG
                      LSAAAQRCWLVLRRHRVILFVTMALCLLAGALFILTSTPDYRATASVEVEDVPAGAAG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAAQRAGSANDTETLMQTELEVLRSRALAEEVARDLSLVGTPTFFKGMDEVRPPEGVGTLSQRQVEQDMVVRLLRDNLE
SAAAQRAGSANDTETLMQTELEVLRSRALAEEVARDLSLVGTPTFFKGMDEVRPPEGVGTLSQRQVEQDMVVRLLRDNLE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VELPGKSRVLRISFVSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARNDLARAERDMAVYATRTGTP
VELPGKSRVLRISFVSADPVLSARVANSYADS                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSGEESKPVKPAAPDGSVATRLAQLNAFRAQAAADRIAAQKRWESARRASADTLPEVLGNGAMQQIMADRAQARAAVAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERQFRKDAHPEMREARAKLAALDEQADSMANTIRASLREQYEVAVRGEDQIAKEIAQLEQQAQVEQGRDVQMGIMERSVD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYRMLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTRPFSPRIGVTLLLASLGGLALGLLLVAARHMFDDAVTSADTLA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERVGLSLLGAVPVTGDNPQPAEIFTPIAASLLLASADGLPRSILVTSAQEGEGKSLTLHALALALAGLGKSVLVIDGDMR
                                             TSAQEGEGKSLTLHALALALAGLGKSVLVIDGDMR
                                                    GKS                 LVIDGDMR
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPVQHRLFRLSPARGISEVLTGQAMAQDVIVDTGIAGVALLPCGTLPPNPSELLSTPALDGLLTAVRDRYDTVLIDAPPI
RPVQHRLFRLSPARGISEVLTGQAMAQDVIVDTGIAGVALLPCGTLPPNPSELLSTPALDGLLTAVRDRYDTVLIDAPPI
                                                                        VLIDAPP 
       650       660       670       680       690       700     
....:....|....:....|....:....|....:....|....:....|....:....|....:
LGIGDAPLLAAKAQASLLVVEWGRNHHGGLRAAVERLRRSGGAIVGAILTKQQGRAMDYDYHRGG
LGIGDAPLLAAKAQASLLVVEWGRNHHGGLRAAVERLRRSGGAIVGAILTKQQGRAMDYDYHRGG
                                                          YDY    

© 1998-2019