BYKdb

Annotate results for A0A0J8A5G4

A0A0J8A5G4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J8A5G4
DOMAINtad1/171MRQYLRIAMRWRYVILGAVAVCFLIGLIATLLMTPQYTASSTIEISREADKVTDLQGVER
EAGIADQEFYQTQYGLLESRALSERVATQLKLTESQNFFEMFGFESDDPAFALANGRYPA
SGRATRQRVAGEILREHLSISPTRMSRLVEIKFTSPDPAFSAKVANTWGEN
DOMAINcd511/700TSTRPIEGKSTTCLALATTLSRGGKRVILIDGDMRNPSVHHLGGVRHDRGLSNYLTGEDN
IDALTFPMEDLGFTAMSAGPLPPNAAELLTGSRLSQLIVQLLETYDHVVIDSPPVMGLAD
APLIAAKVEGVIYVVESHGIRTGLVKEALGRLITANVRIIGCVLTKFDAKKAHYGYGYGY
EYGYRYGRKA
SITEWalker A518/520GKS
SITEWalker A'538/545ILIDGDMR
SITEWalker B618/624VVIDSPP
SITEY Cluster684/696YGYGYGYEYGYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRQYLRIAMRWRYVILGAVAVCFLIGLIATLLMTPQYTASSTIEISREADKVTDLQGVEREAGIADQEFYQTQYGLLESR
MRQYLRIAMRWRYVILGAVAVCFLIGLIATLLMTPQYTASSTIEISREADKVTDLQGVEREAGIADQEFYQTQYGLLESR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALSERVATQLKLTESQNFFEMFGFESDDPAFALANGRYPASGRATRQRVAGEILREHLSISPTRMSRLVEIKFTSPDPAF
ALSERVATQLKLTESQNFFEMFGFESDDPAFALANGRYPASGRATRQRVAGEILREHLSISPTRMSRLVEIKFTSPDPAF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAKVANTWGENFIQTNLERKIQATSYGRDLLQKQLGQLKQRLDESQRQLVNYASSAKIINLPAQSGNGQSSSERSIVVDD
SAKVANTWGEN                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAALNASLAQATASRIEAQARYQQSGRAGASAEALSNSAINSLRQRRAELAAEYRRLMTQFEPGYPAAQAIQAQITQLDR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIAGEEGRVTSSLLADYRRTEEQEKALQAKVEQLKGDYLDLRRRSIQYNIYQQEVDTNQALYDGLLQRFKEIGVAGGVGV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNISIVDPAQAPKLPSSPKLLINLAIALLAGLGIGAALAFGLEQIDEGITDPAEAKRELGLPLLGSIPKIDEAPKDILLD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKSDLVDAYLTVQTNLAFSTEHGVPRSFSVTSTRPIEGKSTTCLALATTLSRGGKRVILIDGDMRNPSVHHLGGVRHDRG
                              TSTRPIEGKSTTCLALATTLSRGGKRVILIDGDMRNPSVHHLGGVRHDRG
                                     GKS                 ILIDGDMR               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSNYLTGEDNIDALTFPMEDLGFTAMSAGPLPPNAAELLTGSRLSQLIVQLLETYDHVVIDSPPVMGLADAPLIAAKVEG
LSNYLTGEDNIDALTFPMEDLGFTAMSAGPLPPNAAELLTGSRLSQLIVQLLETYDHVVIDSPPVMGLADAPLIAAKVEG
                                                         VVIDSPP                
       650       660       670       680       690       700     
....:....|....:....|....:....|....:....|....:....|....:....|....:
VIYVVESHGIRTGLVKEALGRLITANVRIIGCVLTKFDAKKAHYGYGYGYEYGYRYGRKAEPDAA
VIYVVESHGIRTGLVKEALGRLITANVRIIGCVLTKFDAKKAHYGYGYGYEYGYRYGRKA     
                                           YGYGYGYEYGYRY         

© 1998-2019