BYKdb

Annotate results for A0A0J8AKB5

A0A0J8AKB5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0J8AKB5
DOMAINtad28/186DRIDPGLLLAFLRRRWPLILGVLLLCLAAGLVITARQTPTYLSTAEVTLDAKVEPIAPLS
EDDRLAAQGSLGETYIDTQVEVMTSSHNVAGVVDRLGLARDRRFMQEGVNAAGARDAAIA
YVEDGVTAFRSGATYTISVAFESEDPAEAARIANAFAEQ
DOMAINcd534/724TSALPSEGKTTVALCLARSMASGSDRILLIDCDVRRRGVSRWLAGTREVGLLEVLRGDAK
LEDAIVTDPRTGLSILPLSSSAQEDHALLTGTGMDTLLALAAQSFDAVIMDTAPVLPMAD
ARLLLCKADASIIAARWRRTPEAAVRSLLRMLPAGYFGMAGMILTRVDVRKQAAFGVDEN
AFYKAYKDYYA
SITEWalker A541/543GKT
SITEWalker A'561/568LLIDCDVR
SITEWalker B641/647VIMDTAP
SITEY Cluster716/723YKAYKDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKSVVLAPQPGSLVPATRPAAAPAPADRIDPGLLLAFLRRRWPLILGVLLLCLAAGLVITARQTPTYLSTAEVTLDAKV
                           DRIDPGLLLAFLRRRWPLILGVLLLCLAAGLVITARQTPTYLSTAEVTLDAKV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPIAPLSEDDRLAAQGSLGETYIDTQVEVMTSSHNVAGVVDRLGLARDRRFMQEGVNAAGARDAAIAYVEDGVTAFRSGA
EPIAPLSEDDRLAAQGSLGETYIDTQVEVMTSSHNVAGVVDRLGLARDRRFMQEGVNAAGARDAAIAYVEDGVTAFRSGA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYTISVAFESEDPAEAARIANAFAEQYTLGTLADKETGDGKALKEVGARMEAARIQASTDAATLSRYRLAHNLPTTTDRS
TYTISVAFESEDPAEAARIANAFAEQ                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTEQEISAYNQQVTEARAQAAEDTARLATARQQLGMGSAGDDVGEALGSGVVASLRQQQAGYAAEIASLSSKYGPRHPDL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRARSQLDAVTGQIREEIGRVISNLSAKAAVSQKRLDSLSGSLNTSQGALRRDNVAMVDLQDIDQRAQASKSLYENYLSR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKELAARIGIRQPEARVLHPALPSETPARPNFLLNMVLSGALGLALGIICAITAEMMFSGLTSGEDVERRLGVHYLCSVP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELTSVLSRKERGGVAGDPVEAVVDHPRSAFAEAFRNLRASIAFAVENPRIIAITSALPSEGKTTVALCLARSMASGSDRI
                                                     TSALPSEGKTTVALCLARSMASGSDRI
                                                            GKT                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDCDVRRRGVSRWLAGTREVGLLEVLRGDAKLEDAIVTDPRTGLSILPLSSSAQEDHALLTGTGMDTLLALAAQSFDA
LLIDCDVRRRGVSRWLAGTREVGLLEVLRGDAKLEDAIVTDPRTGLSILPLSSSAQEDHALLTGTGMDTLLALAAQSFDA
LLIDCDVR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIMDTAPVLPMADARLLLCKADASIIAARWRRTPEAAVRSLLRMLPAGYFGMAGMILTRVDVRKQAAFGVDENAFYKAYK
VIMDTAPVLPMADARLLLCKADASIIAARWRRTPEAAVRSLLRMLPAGYFGMAGMILTRVDVRKQAAFGVDENAFYKAYK
VIMDTAP                                                                    YKAYK
    
....
DYYA
DYYA
DYY 

© 1998-2019