BYKdb

Annotate results for A0A0J8GB34

A0A0J8GB34 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J8GB34
DOMAINcd43/219TSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPTLHKRFSKNLHLGLSNVMTGDIS
LEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIESLRDSFDKIIIDTPPVTIV
SDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
SITEWalker A50/52GKS
SITEWalker A'70/77LLIDADMR
SITEWalker B152/158IIIDTPP
SITEY Cluster217/219YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNTKRNKRRKDSYSPTSEQFKLIRTGIDFSGIDEKKQVILITSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPT
                                          TSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPT
                                                 GKS                 LLIDADMR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHKRFSKNLHLGLSNVMTGDISLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIESLRDSFDKIIIDTPPVT
LHKRFSKNLHLGLSNVMTGDISLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIESLRDSFDKIIIDTPPVT
                                                                       IIIDTPP  
       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
IVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
IVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
                                                        YYY
© 1998-2019