BYKdb

Annotate results for A0A0J8GCL7

A0A0J8GCL7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J8GCL7
DOMAINcd45/224TSPEVGSGKSTIAANLAIVYAQQGKKTLLIDGDLRKPTVHKTFSKNMFCGLSSVLTDQID
LHEACQNTEVPNLSILTSGAIPPNPNEMLSSNKMTLILEELKQEYDLIIIDTPPVTIVSD
ALVIAQEVDGVILAVRYGVTLKDRIKQAVEQIGMTRTPIIGTVLNGVSEKKSNYYYYAYK
SITEWalker A52/54GKS
SITEWalker A'72/79LLIDGDLR
SITEWalker B152/158IIIDTPP
SITEY Cluster218/223YYYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKTSRKQLIAYKNPTSPVSEQFKTIRTSIDFSAIDSAFQTILVTSPEVGSGKSTIAANLAIVYAQQGKKTLLIDGDLRK
                                            TSPEVGSGKSTIAANLAIVYAQQGKKTLLIDGDLRK
                                                   GKS                 LLIDGDLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTVHKTFSKNMFCGLSSVLTDQIDLHEACQNTEVPNLSILTSGAIPPNPNEMLSSNKMTLILEELKQEYDLIIIDTPPVT
PTVHKTFSKNMFCGLSSVLTDQIDLHEACQNTEVPNLSILTSGAIPPNPNEMLSSNKMTLILEELKQEYDLIIIDTPPVT
                                                                       IIIDTPP  
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
IVSDALVIAQEVDGVILAVRYGVTLKDRIKQAVEQIGMTRTPIIGTVLNGVSEKKSNYYYYAYK
IVSDALVIAQEVDGVILAVRYGVTLKDRIKQAVEQIGMTRTPIIGTVLNGVSEKKSNYYYYAYK
                                                         YYYYAY 
© 1998-2019