BYKdb

Annotate results for A0A0J8GDV6

A0A0J8GDV6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J8GDV6
DOMAINcd47/224TSPEPNNGKSTISANLAVCYAKQGNRTLLIDADMRKPTVHRTFDIRVNVGLSNLLTGDME
RSEVFRQTEIDNLVVLTSGTVPPNPNELLISKKMEKLMQQFSQEFDQIIIDTPPILASSD
ALVLTPYVDGTVVVLRSEKSLKDRTKIAVDQLRKTNVPIIGTVLNCVKNRLDNYYDYS
SITEWalker A54/56GKS
SITEWalker A'74/81LLIDADMR
SITEWalker B154/160IIIDTPP
SITEY Cluster220/223YYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEQITRGRNLITIVNPNGPISEQFKTLRTGIHFSSVDTKYQSIMITSPEPNNGKSTISANLAVCYAKQGNRTLLIDADM
                                              TSPEPNNGKSTISANLAVCYAKQGNRTLLIDADM
                                                     GKS                 LLIDADM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTVHRTFDIRVNVGLSNLLTGDMERSEVFRQTEIDNLVVLTSGTVPPNPNELLISKKMEKLMQQFSQEFDQIIIDTPP
RKPTVHRTFDIRVNVGLSNLLTGDMERSEVFRQTEIDNLVVLTSGTVPPNPNELLISKKMEKLMQQFSQEFDQIIIDTPP
R                                                                        IIIDTPP
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
ILASSDALVLTPYVDGTVVVLRSEKSLKDRTKIAVDQLRKTNVPIIGTVLNCVKNRLDNYYDYS
ILASSDALVLTPYVDGTVVVLRSEKSLKDRTKIAVDQLRKTNVPIIGTVLNCVKNRLDNYYDYS
                                                           YYDY 
© 1998-2019