BYKdb

Annotate results for A0A0J8GH97

A0A0J8GH97 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J8GH97
DOMAINcd49/232TSPTQDSGKTMISVNLASTYANDGVKTLIVDLDLRRPSLGFAFPFLKSCPGLTGILDSSQ
KLTLDDAIVKIGDTNLYALPVGVRPVSPYSILNSEKLVQLIKQLQEEFDMIIIDTPPVLM
VTDALLISKWVEACILIARGSYSNKKDVRKSLKSLRDSNANVLGAIFNNPQMKQTNYYYA
ESDA
SITEWalker A56/58GKT
SITEWalker A'76/83LIVDLDLR
SITEWalker B159/165IIIDTPP
SITEY Cluster225/227YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKTDKKDIKNRLVALHEPSNPQAEYFRTIKTNIEMANIDSQIKSLLITSPTQDSGKTMISVNLASTYANDGVKTLIVDL
                                                TSPTQDSGKTMISVNLASTYANDGVKTLIVDL
                                                       GKT                 LIVDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRPSLGFAFPFLKSCPGLTGILDSSQKLTLDDAIVKIGDTNLYALPVGVRPVSPYSILNSEKLVQLIKQLQEEFDMII
DLRRPSLGFAFPFLKSCPGLTGILDSSQKLTLDDAIVKIGDTNLYALPVGVRPVSPYSILNSEKLVQLIKQLQEEFDMII
DLR                                                                           II
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
IDTPPVLMVTDALLISKWVEACILIARGSYSNKKDVRKSLKSLRDSNANVLGAIFNNPQMKQTNYYYAESDA
IDTPPVLMVTDALLISKWVEACILIARGSYSNKKDVRKSLKSLRDSNANVLGAIFNNPQMKQTNYYYAESDA
IDTPP                                                           YYY     
© 1998-2019