BYKdb

Annotate results for A0A0J9F007

A0A0J9F007 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0J9F007
DOMAINcd41/230TSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIVKRHEIQGNPCGLSQYLSGQK
TAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKY
YGKYYGRYYG
SITE-230/-232GKT
SITEWalker A'68/75LLIDGDIR
SITEWalker B149/155IIIDTPP
SITE-146/-148YDY
SITEY Cluster212/233YDNGYYKKYYGKYYGRYYGKTY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
                                        TSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
                                               GKS                 LLIDGDIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYG          
                                                   YDNGYYKKYYGKYYGRYYGKTY       
       
....:..
QILDEAR


© 1998-2019