BYKdb

Annotate results for A0A0K0TR74

A0A0K0TR74 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K0TR74
DOMAINtad4/155DAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTILPGE
SRGSAPLNDTARLESAVELIGSERTLQAVVRDLGLAVGMPGATAMEREHQAIRWLGERIK
AQRRGQTYLISVRASAGDPLMAARLANGVANA
DOMAINcd358/550ASATPGEGKTTLALALARSYALAGHSSLVIDCDLRNPSLHKHLGLEPCCGLFEYLTGPSE
PSRLKAMLIPDDISGAHLAVGGLGAHKATDDLIAGPAFARLIAAAKRSFELVILDSPPMG
TVVDGLYLAPFADVVAFVMRYRSTPRAAAVQALAALENSRDGRSALVGVLNLHPEPGVAK
GYRASVYTTRELS
SITEWalker A365/367GKT
SITEWalker A'385/392LVIDCDLR
SITEWalker B469/475VILDSPP
SITEY Cluster539/544YRASVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTILPGESRGSAPLNDTARLESAV
   DAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTILPGESRGSAPLNDTARLESAV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELIGSERTLQAVVRDLGLAVGMPGATAMEREHQAIRWLGERIKAQRRGQTYLISVRASAGDPLMAARLANGVANAFLRIE
ELIGSERTLQAVVRDLGLAVGMPGATAMEREHQAIRWLGERIKAQRRGQTYLISVRASAGDPLMAARLANGVANA     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEGKVDDILAEQAALRDRVIAAGVAVDRTQGILDATAEPGYEARQEAQAAQAQYQMLLGRLKQVETEAFLQVPSTRIVVE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAPLYAAAPRSNLALALAAGFATVLGLLVALVRERTTTGFVDEQEAVRTLGVKPILSVPRQKLQRGVDGEWCLSPADQL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRAPLAEFPEAVRRLRVSIDQARHREGLDHAGTVVMMASATPGEGKTTLALALARSYALAGHSSLVIDCDLRNPSLHKHL
                                     ASATPGEGKTTLALALARSYALAGHSSLVIDCDLRNPSLHKHL
                                            GKT                 LVIDCDLR        
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLEPCCGLFEYLTGPSEPSRLKAMLIPDDISGAHLAVGGLGAHKATDDLIAGPAFARLIAAAKRSFELVILDSPPMGTVV
GLEPCCGLFEYLTGPSEPSRLKAMLIPDDISGAHLAVGGLGAHKATDDLIAGPAFARLIAAAKRSFELVILDSPPMGTVV
                                                                    VILDSPP     
       490       500       510       520       530       540       550    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DGLYLAPFADVVAFVMRYRSTPRAAAVQALAALENSRDGRSALVGVLNLHPEPGVAKGYRASVYTTRELSPSAR
DGLYLAPFADVVAFVMRYRSTPRAAAVQALAALENSRDGRSALVGVLNLHPEPGVAKGYRASVYTTRELS    
                                                          YRASVY          
© 1998-2019