BYKdb

Annotate results for A0A0K0XYJ6

A0A0K0XYJ6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K0XYJ6
DOMAINtad37/232DAIDLLEIWRTILKRKWVVVSILAVFIATAALSSWLTIPVYRATAVVQINHETANILRIE
DFEAAPRSWQGVEQFYQTQYEILRGRQLAENVVEKLEVWDHPELSGEITQRNLYRELRAL
PGRLMQLIRSDPPSAQPGTAVQTPEAAREAAIRSAGGRLRARISVNPRENSRLVYVSVNS
FDPAFAAQLANAVVEE
DOMAINcd582/774TSPGPGDGKTTNAINLATVLAQNGARVLLIDADLRKPRLHRDFSIQQSPGLTNRIAEVSS
QEVTTSSIIPTTTEGLFVMPSGNQAPNPAELLSSDRMRKIINLSARAFDHVIIDSAPILG
LADALVLSRCVDGVILVTSAGKTSKESIRTSTRRLVQVHAPLLGVVMNRIDMESPDYAYY
SSYYYNYSHDEDE
SITE-722/-724GKT
SITEWalker A'609/616LLIDADLR
SITEWalker B692/698VIIDSAP
SITEY Cluster758/768YAYYSSYYYNY
SITEWalker A589/591GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDQRIQDGRHLRPIDGQNLALAQYDPYQSKANEDDDAIDLLEIWRTILKRKWVVVSILAVFIATAALSSWLTIPVYRAT
                                    DAIDLLEIWRTILKRKWVVVSILAVFIATAALSSWLTIPVYRAT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVQINHETANILRIEDFEAAPRSWQGVEQFYQTQYEILRGRQLAENVVEKLEVWDHPELSGEITQRNLYRELRALPGRL
AVVQINHETANILRIEDFEAAPRSWQGVEQFYQTQYEILRGRQLAENVVEKLEVWDHPELSGEITQRNLYRELRALPGRL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQLIRSDPPSAQPGTAVQTPEAAREAAIRSAGGRLRARISVNPRENSRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQR
MQLIRSDPPSAQPGTAVQTPEAAREAAIRSAGGRLRARISVNPRENSRLVYVSVNSFDPAFAAQLANAVVEE        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYDAGQEAREFLEGQLADMRIALERADQNLIDFAQANGVADLEERINMSQSSVRTLNDRLSGARGDLVQLRAFNQLIEQG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGDSIRPVVNDGQIAELRGRKAELETEISGLLQRFMEDYPAIAELRSQINEIDSQIRERADFIIGNVIAEYSNLEAEVAA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEEAIAENEGRILALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRPGYPVLPDISRNLSI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLLGLVVGVGLALLLEFLDSTVHRTEDVEKLVGRPVLGLIPIVKLSEQRKKSGTTTRAEDRAVSHYSELHPKSAVSEAF


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSLRTSLMFSTPQGMPKTILMTSPGPGDGKTTNAINLATVLAQNGARVLLIDADLRKPRLHRDFSIQQSPGLTNRIAEVS
                     TSPGPGDGKTTNAINLATVLAQNGARVLLIDADLRKPRLHRDFSIQQSPGLTNRIAEVS
                            GKT                 LLIDADLR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQEVTTSSIIPTTTEGLFVMPSGNQAPNPAELLSSDRMRKIINLSARAFDHVIIDSAPILGLADALVLSRCVDGVILVTS
SQEVTTSSIIPTTTEGLFVMPSGNQAPNPAELLSSDRMRKIINLSARAFDHVIIDSAPILGLADALVLSRCVDGVILVTS
                                                   VIIDSAP                      
       730       740       750       760       770       780       790 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
AGKTSKESIRTSTRRLVQVHAPLLGVVMNRIDMESPDYAYYSSYYYNYSHDEDERVEGGRNKAGKNLERTA
AGKTSKESIRTSTRRLVQVHAPLLGVVMNRIDMESPDYAYYSSYYYNYSHDEDE                 
                                     YAYYSSYYYNY                       

© 1998-2019