BYKdb

Annotate results for A0A0K1E9I7

A0A0K1E9I7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K1E9I7
DOMAINtad1/162MAWRTVRKHWVIALATAVGVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDAVVE
MGTGSYWNNREYYETQYKIIQSMRVALAVVRDLSLHNDSAFLENLPPGRPGSGKTVTPEE
AAEVLRERLAVDPVKESRLAIVRFTDADAQRAQRVLSVVVNT
DOMAINcd525/712TSAGPSEGKTTVACCIATAMAQAEQRVIMVDCDLRRPRLHRVFGKGTDVGVTTALLDGEL
PSDEVMRTEVPNLWVLPAGPLPPNPAELFHSARFRMLLDQLSARFDRVIIDSPPVVAVTD
AAILSTLSEGTVLVARAFKTQRELARHGVKSLLDVGGTAAGVVLNAVDLDRQEYRYYHYY
SYKKEGYY
SITEWalker A532/534GKT
SITEWalker A'552/559IMVDCDLR
SITEWalker B632/638VIIDSPP
SITEY Cluster698/712YRYYHYYSYKKEGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAWRTVRKHWVIALATAVGVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDAVVEMGTGSYWNNREYYETQYKII
MAWRTVRKHWVIALATAVGVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDAVVEMGTGSYWNNREYYETQYKII

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSMRVALAVVRDLSLHNDSAFLENLPPGRPGSGKTVTPEEAAEVLRERLAVDPVKESRLAIVRFTDADAQRAQRVLSVVV
QSMRVALAVVRDLSLHNDSAFLENLPPGRPGSGKTVTPEEAAEVLRERLAVDPVKESRLAIVRFTDADAQRAQRVLSVVV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTYVEQNLEDVLASTDSAVEWLRTQLDKLKGDLEASEMALHEYKIDKHILSVAIDDQSNMLREEMKQLNEALTLVRTRRE
NT                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRARRDELAKVKASDPVDLPSSELLQSVTLQTLRERYEETVREQKALLGEGKGPRHPDMRAAEERVGATKAALLSEVKN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQGALDRDLAVVSRQEGALAGLFGRAQKQAFDLNLLEIEYNRLRRSKDNTEKLYALVLERTKEADLTRMMRVNNIRVPDP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLVQRKPIRPRVPMNLAAGLLAGVGLGVAAALGRAMLDRTLKTPDDVEQELGLPFLGLLPEISPEEKHAKGKRPRPRRGG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGGGTSRELIVHEQPFSGAAEAARAVRTNLLFMAPDNPYRILLITSAGPSEGKTTVACCIATAMAQAEQRVIMVDCDLRR
                                            TSAGPSEGKTTVACCIATAMAQAEQRVIMVDCDLRR
                                                   GKT                 IMVDCDLR 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRLHRVFGKGTDVGVTTALLDGELPSDEVMRTEVPNLWVLPAGPLPPNPAELFHSARFRMLLDQLSARFDRVIIDSPPVV
PRLHRVFGKGTDVGVTTALLDGELPSDEVMRTEVPNLWVLPAGPLPPNPAELFHSARFRMLLDQLSARFDRVIIDSPPVV
                                                                       VIIDSPP  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVTDAAILSTLSEGTVLVARAFKTQRELARHGVKSLLDVGGTAAGVVLNAVDLDRQEYRYYHYYSYKKEGYYGQVDGDPE
AVTDAAILSTLSEGTVLVARAFKTQRELARHGVKSLLDVGGTAAGVVLNAVDLDRQEYRYYHYYSYKKEGYY        
                                                         YRYYHYYSYKKEGYY        
       730    
....:....|....
ARPDDRPGDSAAAS


© 1998-2019