BYKdb

Annotate results for A0A0K1QRZ4

A0A0K1QRZ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K1QRZ4
DOMAINcd87/262TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLSMEKSLNEYLADEA
ELQEVLVNPTLPRFVVLPTRKPIPLSTEVLSSPKVSHLISDLRERYNSRVVIFDLPPILS
SDDVITVLPKFDCVLLVVANGMNSRKEIEESLHHLGTANLIGTVLNKAEPQNRSYY
SITEWalker A94/96GKT
SITEWalker A'115/122LLVDFDLR
SITEWalker B197/203VIFDLPP
SITEY Cluster261/262YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEIIKPDTENTEPKNSSKAMTPTAHSSGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLSMEKSLNEYLADEAELQEVLVNPTLPRF
      TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLSMEKSLNEYLADEAELQEVLVNPTLPRF
             GKT                  LLVDFDLR                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLPTRKPIPLSTEVLSSPKVSHLISDLRERYNSRVVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNSRKEIEESLHH
VVLPTRKPIPLSTEVLSSPKVSHLISDLRERYNSRVVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNSRKEIEESLHH
                                    VIFDLPP                                     
       250       260  
....:....|....:....|..
LGTANLIGTVLNKAEPQNRSYY
LGTANLIGTVLNKAEPQNRSYY
                    YY
© 1998-2019