BYKdb

Annotate results for A0A0K2D937

A0A0K2D937 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K2D937
DOMAINtad1/172MGLLRRQRLAIAVTVAAILGLVVLALSQVPSRYSATTLVMIDPREQRLVSLDNAAPAPPN
IGAVDGEVEIMASPVIARRVIARLNLQDDEEFNRPDLLAQIAAGLWPAAVDGAEGQLQPG
QPLSPRVERRIIDRLARRVDISRRGVTSIIAVEASSRDPDKAARIANAYAQA
DOMAINcd511/703TSTKPGEGKSVTAVALGRAAALAGRRTLVIDCDLRKPSVHRLLKAKVKTSLVDILADRAT
TAHVNDMRVVDALSDMSAFVSGDAQYFPAESILDSARFRALLEGCRKAFDVIILDAPPLA
VVSDPLLLAVYADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVDASSGEESY
YPYTTNGRKPGEA
SITEWalker A518/520GKS
SITEWalker A'538/545LVIDCDLR
SITEWalker B622/628IILDAPP
SITE-641/-647YADVVLY
SITEY Cluster690/693YYPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLLRRQRLAIAVTVAAILGLVVLALSQVPSRYSATTLVMIDPREQRLVSLDNAAPAPPNIGAVDGEVEIMASPVIARRV
MGLLRRQRLAIAVTVAAILGLVVLALSQVPSRYSATTLVMIDPREQRLVSLDNAAPAPPNIGAVDGEVEIMASPVIARRV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IARLNLQDDEEFNRPDLLAQIAAGLWPAAVDGAEGQLQPGQPLSPRVERRIIDRLARRVDISRRGVTSIIAVEASSRDPD
IARLNLQDDEEFNRPDLLAQIAAGLWPAAVDGAEGQLQPGQPLSPRVERRIIDRLARRVDISRRGVTSIIAVEASSRDPD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAARIANAYAQAYIDDQIASRLRLVANAERVLASRVTDLGEELRRAEAELDRYTLEQMMERAGEDGRNRLLSLRTTLEED
KAARIANAYAQA                                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAARTDALTRLRALEALVQAGDAAGIARVLAGGESEQLTEERREIERQLSARLPAARAAALRTRLTAIDARIVALGSARA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EELQRTADVSEQRAQQVRRDLDMLVNASDLPADASVQLYKLREEVAATRALYQNYLGRLRQVSQQRGLVLADSRVVAEAM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVRPSFPPTVPILFASLFLAFGAGFGIAWVRDTYGRGFLRADEVEEATGLDVVASMPQVEAAKGGVPVQDKVVREPGSA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAEAIRRLRLGLDILMSAGEGEAAGKVVLVTSTKPGEGKSVTAVALGRAAALAGRRTLVIDCDLRKPSVHRLLKAKVKTS
                              TSTKPGEGKSVTAVALGRAAALAGRRTLVIDCDLRKPSVHRLLKAKVKTS
                                     GKS                 LVIDCDLR               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDILADRATTAHVNDMRVVDALSDMSAFVSGDAQYFPAESILDSARFRALLEGCRKAFDVIILDAPPLAVVSDPLLLAV
LVDILADRATTAHVNDMRVVDALSDMSAFVSGDAQYFPAESILDSARFRALLEGCRKAFDVIILDAPPLAVVSDPLLLAV
                                                             IILDAPP            
       650       660       670       680       690       700    
....:....|....:....|....:....|....:....|....:....|....:....|....
YADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVDASSGEESYYPYTTNGRKPGEAS
YADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVDASSGEESYYPYTTNGRKPGEA 
                                                 YYPY           

© 1998-2019