BYKdb

Annotate results for A0A0K2DKM2

A0A0K2DKM2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K2DKM2
DOMAINtad1/150MILALTILALVLIEPRYSATAVVLIDPRQQRVISAEAVLSGIGSDAAAVESQVEVIESPT
LALRVIEREKLENDPEFARRGFLARVAEQLSIGRHASGHDEAALRRAAVLEALRERTRVK
RRGLTYVLEITVTSQSPQKAARLANAVADE
DOMAINcd518/707VSALPGEGKSTIAANLALALKAAGERVVLVDGDLRNPALTRALTPHAEQGLIEVLRGEQP
LETILVEDEATGLTFLPTVRAGAVANAAELIETGHFDTMLKRLRLAFDHVIVDAAPLLPV
VDSRAIVARADGALLVVEWGRTDRAAVQEAMRTLADNADRVTGAVLSKATTDAYQYHYGI
GGYGGADGEA
SITEWalker A525/527GKS
SITEWalker A'545/552VLVDGDLR
SITEWalker B627/633VIVDAAP
SITEY Cluster691/700YQYHYGIGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MILALTILALVLIEPRYSATAVVLIDPRQQRVISAEAVLSGIGSDAAAVESQVEVIESPTLALRVIEREKLENDPEFARR
MILALTILALVLIEPRYSATAVVLIDPRQQRVISAEAVLSGIGSDAAAVESQVEVIESPTLALRVIEREKLENDPEFARR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFLARVAEQLSIGRHASGHDEAALRRAAVLEALRERTRVKRRGLTYVLEITVTSQSPQKAARLANAVADEYLAGQLAAKY
GFLARVAEQLSIGRHASGHDEAALRRAAVLEALRERTRVKRRGLTYVLEITVTSQSPQKAARLANAVADE          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RATERASLWLGARLEELREQVRGAERAVEHYKAEHNLVSVGSGDNLLEQQIAEINQQMILARAKTAEARAKFAQIREAAG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGGGAPGIAEALGSLVVTNLRTQFAEAARRVAELGARYGGQHPSVTAARAQVDDLQQQIDAELARILSGVRNEYEVAVGR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EASLEASLAELKKEAARWGESTVRLRELEREAKALRSVYEQFLARSKETLEQQSLQIADAEIISPAMVPMRPSYPRTLLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVACAGSLLTGLSLAFAFEHLDPGFRSIEQVEAYLGLPCLGVLPLVEEQARPVQSEPRTAGPATSRSWLWAVDRPADAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRILVEQPLSAFAEAVRTVRVGLRFADRGRGVQVLVVVSALPGEGKSTIAANLALALKAAGERVVLVDGDLRNPALTRAL
                                     VSALPGEGKSTIAANLALALKAAGERVVLVDGDLRNPALTRAL
                                            GKS                 VLVDGDLR        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPHAEQGLIEVLRGEQPLETILVEDEATGLTFLPTVRAGAVANAAELIETGHFDTMLKRLRLAFDHVIVDAAPLLPVVDS
TPHAEQGLIEVLRGEQPLETILVEDEATGLTFLPTVRAGAVANAAELIETGHFDTMLKRLRLAFDHVIVDAAPLLPVVDS
                                                                  VIVDAAP       
       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
RAIVARADGALLVVEWGRTDRAAVQEAMRTLADNADRVTGAVLSKATTDAYQYHYGIGGYGGADGEA
RAIVARADGALLVVEWGRTDRAAVQEAMRTLADNADRVTGAVLSKATTDAYQYHYGIGGYGGADGEA
                                                  YQYHYGIGGY       

© 1998-2019