BYKdb

Annotate results for A0A0K2GDM9

A0A0K2GDM9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K2GDM9
DOMAINcd83/269TSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKPSIAAQLGLRDNIVGLRDAALNA
GLRLKDVVRRHPAWNLSIATAGRAQGLPHEIIKSARFAELLNEARRDYEWIFLDTPPLML
APDCLILGRNVDGFLMVVYANKTSRQEVAEALNSLGPSKLLGLVYNGDDRLLSSYNYGAY
YMTPESG
SITEWalker A90/92GKT
SITEWalker A'111/118LLMDVDFR
SITEWalker B193/199IFLDTPP
SITEY Cluster257/263YNYGAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKDVNPALRAVPPPESGSSSAYQRGDSRGDAPVLEKMLGRAKPDEHLVSLLTPATFEAEQYRTLGLMLEQRRQTGLLQVV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMTSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKPSIAAQLGLRDNIVGLRDAALNAGLRLKDVVRRHPAWNLSI
  TSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKPSIAAQLGLRDNIVGLRDAALNAGLRLKDVVRRHPAWNLSI
         GKT                  LLMDVDFR                                          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAGRAQGLPHEIIKSARFAELLNEARRDYEWIFLDTPPLMLAPDCLILGRNVDGFLMVVYANKTSRQEVAEALNSLGPS
ATAGRAQGLPHEIIKSARFAELLNEARRDYEWIFLDTPPLMLAPDCLILGRNVDGFLMVVYANKTSRQEVAEALNSLGPS
                                IFLDTPP                                         
       250       260         
....:....|....:....|....:....
KLLGLVYNGDDRLLSSYNYGAYYMTPESG
KLLGLVYNGDDRLLSSYNYGAYYMTPESG
                YNYGAYY      
© 1998-2019