BYKdb

Annotate results for A0A0K2GIJ9

A0A0K2GIJ9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K2GIJ9
DOMAINtad20/198PEHPLREYASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQAPGGLEKD
KSYYHLDNSPEYFQTHFELLKSHQVIRRAVDQLKLSNRPEYQPQPSLLDKVLPKWVQAWW
QPKKKEGPLAEEAEQERLLKAFLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSV
DOMAINcd550/737TSPGDNEGKTTLAVNLALALARLERRRVVLVDVDFRKPNPHRIYEVGLHKTSAPGLAQLL
AGQADIADVVHDSFVPNLSIVPSGDRPGNPTELLHSKYLTQLLEWALRQDCHMILDCPPT
LPFADTAVLASKVDGVLMVVCAGKTTREACRLAIQRMAFAGGKMLGVVMQKARVEDSPYY
TAYYQEQA
SITE-692/-694GKT
SITEWalker A'578/585VLVDVDFR
SITEWalker B662/668MILDCPP
SITEY Cluster728/733YYTAYY
SITEWalker A557/559GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERRNGLPADRTAPGAADEPEHPLREYASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQAPGGLEKDK
                   PEHPLREYASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQAPGGLEKDK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYYHLDNSPEYFQTHFELLKSHQVIRRAVDQLKLSNRPEYQPQPSLLDKVLPKWVQAWWQPKKKEGPLAEEAEQERLLKA
SYYHLDNSPEYFQTHFELLKSHQVIRRAVDQLKLSNRPEYQPQPSLLDKVLPKWVQAWWQPKKKEGPLAEEAEQERLLKA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSVYVERNQELSSIAREQAARWFTTHLEGLREKVQAAQEALYLYR
FLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSV                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKHGLLTGEERKSLAGQTMAELNSQLVKTEMAKAAAYSRLQQVESALNTQGQPGSGGGWPELDSLTQVLNSQLIQMLRAQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIALSSQVADLSEKYGPLHPDRAQKHAELQNLRQRIKQEVQKIYDSLKHEYNMTVAQERAVQAAIARYGNDKIRLEKNEI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EHGMLEREAESSLHVYNLFLKATKESDLSAGMQTNNVYLADPATPSAVPAKPKTKLNIVLALMTGLMSGVGLAIVLEARN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKLQDPGDVERYLPEVSLLGVVPLLPKASTPEKALVHPDAMSPAAESIRIIRTGLLLSRPDTLPSRVLITSPGDNEGKTT
                                                                     TSPGDNEGKTT
                                                                            GKT 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVNLALALARLERRRVVLVDVDFRKPNPHRIYEVGLHKTSAPGLAQLLAGQADIADVVHDSFVPNLSIVPSGDRPGNPT
LAVNLALALARLERRRVVLVDVDFRKPNPHRIYEVGLHKTSAPGLAQLLAGQADIADVVHDSFVPNLSIVPSGDRPGNPT
                 VLVDVDFR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGKTTREACRLAIQRMAFAGGKMLGVVMQK
ELLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGKTTREACRLAIQRMAFAGGKMLGVVMQK
                     MILDCPP                                                    
       730       
....:....|....:..
ARVEDSPYYTAYYQEQA
ARVEDSPYYTAYYQEQA
       YYTAYY    

© 1998-2019