BYKdb

Annotate results for A0A0K2J6Z0

A0A0K2J6Z0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K2J6Z0
DOMAINtad25/270SFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSGAPRS
MKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVS
IRITDRDSTESYSFKIDIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQID
KTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISLADKNATIVNLSMKNEDMDCAKDFL
NVLISS
DOMAINcd606/796TSANTGSGKSFMTVNLAITIALTGKKVIVVDLDIRKGSLSKRLGSGNIGVTDFLYNNSIS
VDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVPAMSVA
DAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYG
YGYGYGNKEYG
SITEWalker A613/615GKS
SITEWalker A'633/640IVVDLDIR
SITEWalker B714/720VFLDSVP
SITE-711/-713YDY
SITEY Cluster782/795YGYGYGYGYGNKEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
                        SFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
ADKNATIVNLSMKNEDMDCAKDFLNVLISS                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NALRLAITESNAKIVDAADGPSAPIAPRKPLIFMAASLLGLVIPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAITIALTGKKVIVVDLDIR
                                             TSANTGSGKSFMTVNLAITIALTGKKVIVVDLDIR
                                                    GKS                 IVVDLDIR
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGSLSKRLGSGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVP
KGSLSKRLGSGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVP
                                                                         VFLDSVP
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQGK
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYG    
                                                             YGYGYGYGYGNKEY     
       810       820 
....:....|....:....|.
KLRRRSAKKTKKFKIGPMKKS


© 1998-2019