BYKdb

Annotate results for A0A0K2LE28

A0A0K2LE28 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K2LE28
DOMAINcd73/261TSSAPSEGKSTVSNNVAVSWAKQDKRVILIDADLRRPTIHRTFGVSNHLGLSNYLSGTVD
LETVIQPTMVENLFVITSGPTAPNPSELLGGNRINEMLATLTEQFDCLIFDAPPINSVTD
AQVLATRVDGVILVVPCGIANKVGVTQAKKSLETVHAHILGFIMNRMTKENMEGYYGGEY
SGYYGAIQK
SITEWalker A80/82GKS
SITEWalker A'100/107ILIDADLR
SITEWalker B180/186LIFDAPP
SITEY Cluster247/256YYGGEYSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEINQILRRGGSKVAFKLFKKTAKKLDNYSLSHGVSLVTYDNPISTISEQFNTIRTNIQFSSVDRNLQSILFTSSAPSEG
                                                                        TSSAPSEG
                                                                               G
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTVSNNVAVSWAKQDKRVILIDADLRRPTIHRTFGVSNHLGLSNYLSGTVDLETVIQPTMVENLFVITSGPTAPNPSEL
KSTVSNNVAVSWAKQDKRVILIDADLRRPTIHRTFGVSNHLGLSNYLSGTVDLETVIQPTMVENLFVITSGPTAPNPSEL
KS                 ILIDADLR                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGGNRINEMLATLTEQFDCLIFDAPPINSVTDAQVLATRVDGVILVVPCGIANKVGVTQAKKSLETVHAHILGFIMNRMT
LGGNRINEMLATLTEQFDCLIFDAPPINSVTDAQVLATRVDGVILVVPCGIANKVGVTQAKKSLETVHAHILGFIMNRMT
                   LIFDAPP                                                      
       250       260 
....:....|....:....|.
KENMEGYYGGEYSGYYGAIQK
KENMEGYYGGEYSGYYGAIQK
      YYGGEYSGYY     
© 1998-2019