BYKdb

Annotate results for A0A0K2M5H0

A0A0K2M5H0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K2M5H0
DOMAINtad10/159SPIDIQQYWLIFKRRWPVASVVFAFVFGVTALVTYSTKPVYESEGKLVFTKKSGASSLSS
LSQQMGELGALTNLSNPVDTESEIIRSYPIVIKTITTLKLTDNQGKQLSLEVFLKKLKLK
TVRGTDVMQLSYRSTNPQEAADVVNSLMKY
DOMAINcd532/719TSATPGEGKSFVAANLALAAAYVGRRVLLVDADMRLPRQHRVWEIHNLLGLSNILAGQAQ
LENAVQEVSPLVNMLPAGKIPPNPVALLDSQRMAALVEEASKDYDFVIIDTPPLTAVTDP
LIVGKYVDGLLLVVRPGAVEYSAVTAAKSLLEQARVPILGMVVNGIGKESGYGGYYYASG
YYGGKEDK
SITEWalker A539/541GKS
SITEWalker A'559/566LLVDADMR
SITEWalker B638/644VIIDTPP
SITEY Cluster703/713YGGYYYASGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSINQEDQDSPIDIQQYWLIFKRRWPVASVVFAFVFGVTALVTYSTKPVYESEGKLVFTKKSGASSLSSLSQQMGELGAL
         SPIDIQQYWLIFKRRWPVASVVFAFVFGVTALVTYSTKPVYESEGKLVFTKKSGASSLSSLSQQMGELGAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNLSNPVDTESEIIRSYPIVIKTITTLKLTDNQGKQLSLEVFLKKLKLKTVRGTDVMQLSYRSTNPQEAADVVNSLMKYY
TNLSNPVDTESEIIRSYPIVIKTITTLKLTDNQGKQLSLEVFLKKLKLKTVRGTDVMQLSYRSTNPQEAADVVNSLMKY 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESNVRTNRTEARSAREFLSKELPEVEHRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGKLNEAITQSQGELAAALTR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVALQNEMKLGTQQAVDLSTLSQSPGVQQVLTEYQKTQSELAVARSLYTGDNPKVVDLVMKEASLKNVLEQRVSQTVGSS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFLSKQNLQIGELKQALTQDLVKSEVERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQLTVAQITYQEFLKQF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLVQVLENQNVGNSRIISGALVPERPISPKIPLNLALGGFLGVILGAGTALVLESMNQSLKNIEEANRLLGFPLLGTIPQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGEKNPKNRQEGRQELPLLDDPYSPVSTSFEMLQTNLGFTCSDKELRVILVTSATPGEGKSFVAANLALAAAYVGRRVLL
                                                   TSATPGEGKSFVAANLALAAAYVGRRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADMRLPRQHRVWEIHNLLGLSNILAGQAQLENAVQEVSPLVNMLPAGKIPPNPVALLDSQRMAALVEEASKDYDFVII
VDADMRLPRQHRVWEIHNLLGLSNILAGQAQLENAVQEVSPLVNMLPAGKIPPNPVALLDSQRMAALVEEASKDYDFVII
VDADMR                                                                       VII
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPPLTAVTDPLIVGKYVDGLLLVVRPGAVEYSAVTAAKSLLEQARVPILGMVVNGIGKESGYGGYYYASGYYGGKEDKK
DTPPLTAVTDPLIVGKYVDGLLLVVRPGAVEYSAVTAAKSLLEQARVPILGMVVNGIGKESGYGGYYYASGYYGGKEDK 
DTPP                                                          YGGYYYASGYY       
       730     
....:....|....:
KSSEANVRSGFFGRV


© 1998-2019