BYKdb

Annotate results for A0A0K2MHY2

A0A0K2MHY2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K2MHY2
DOMAINcd55/238TSAEAAEGKSTVSGNLALSFAQNEKRVIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKED
LDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIKKLGEKYDIVILDSAPLQAVTDA
QILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSS
EEGK
SITEWalker A62/64GKS
SITEWalker A'82/89IIVDCDLR
SITEWalker B161/167VILDSAP
SITEY Cluster227/231YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKR
                                                      TSAEAAEGKSTVSGNLALSFAQNEKR
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIKKLGEKYDI
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIKKLGEKYDI
 IIVDCDLR                                                                       
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
VILDSAP                                                           YYYYY       
© 1998-2019