BYKdb

Annotate results for A0A0K2MKT3

A0A0K2MKT3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K2MKT3
DOMAINcd55/240TSAEMAEGKSTVAGNIAVSFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAA
IEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDA
QILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGND
EDKDNL
SITEWalker A62/64GKS
SITEWalker A'82/89ILVDCDLR
SITEWalker B161/167VVLDTAP
SITEY Cluster227/231YSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAVSFAQNEKK
                                                      TSAEMAEGKSTVAGNIAVSFAQNEKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
 ILVDCDLR                                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
VVLDTAP                                                           YSYYY         
© 1998-2019