BYKdb

Annotate results for A0A0K6GZW5

A0A0K6GZW5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K6GZW5
DOMAINtad2/181NEFDLQSLTGLLRRQRFTIAVTVIAVLGLVILVLSQIPSRYSATTLVMIDPREQRLVSLD
NVTPAPPNIGAVDGEVEIMASPVIARRVIARLNLQDDEEFNRPDLLTQIAAGLWPAAVDG
SEGQAQPGQPLPPRVERRIIDRLARRVDIARRGVTSIIAIEASSRDPDKAARIANAYAQA
DOMAINcd521/712TSTKPGEGKSVTAVALGRAAALAGRRTLLIDCDLRKPSVHRLLKVDVKTGLVDILADRAT
TAHVNDVRVIDPLSDMSAFISGDAQFFPAESILDSARFRALLEGCRKAFDVIILDAPPLA
VVSDPLLLAVYADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVAAASGEGSY
YPYAAKGRKPGG
SITEWalker A528/530GKS
SITEWalker A'548/555LLIDCDLR
SITEWalker B632/638IILDAPP
SITE-651/-657YADVVLY
SITEY Cluster700/703YYPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEFDLQSLTGLLRRQRFTIAVTVIAVLGLVILVLSQIPSRYSATTLVMIDPREQRLVSLDNVTPAPPNIGAVDGEVEIM
 NEFDLQSLTGLLRRQRFTIAVTVIAVLGLVILVLSQIPSRYSATTLVMIDPREQRLVSLDNVTPAPPNIGAVDGEVEIM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASPVIARRVIARLNLQDDEEFNRPDLLTQIAAGLWPAAVDGSEGQAQPGQPLPPRVERRIIDRLARRVDIARRGVTSIIA
ASPVIARRVIARLNLQDDEEFNRPDLLTQIAAGLWPAAVDGSEGQAQPGQPLPPRVERRIIDRLARRVDIARRGVTSIIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEASSRDPDKAARIANAYAQAYIEDQIASRLRLVANAERVLASRVTDLGEELRRAEAELDRFTLEQAMERMGEDGRNRLV
IEASSRDPDKAARIANAYAQA                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRTALEEDIAARTDALARLRTLEPLVQDADTTGIARALAGGESDALTEERREIERQLSAGRLPPARVTALRTRIAAIDA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIVALGRARTEELQRAADASEQRAQQVRRDLDMLVNTSDLPADASVQLYKLREEVAANRALYQNYLGRLRQVSQQRGLVL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADSRIVAEAMAAVRPSFPPTLPILVASLFLAFGAGFGIAWVRDTFGRGFLKADEVEEATGLDVVASLPQVESARAAVPVQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKVVREPGSGYAEAIRRLRLGLDILMSAGEGEAGGKVVLVTSTKPGEGKSVTAVALGRAAALAGRRTLLIDCDLRKPSVH
                                        TSTKPGEGKSVTAVALGRAAALAGRRTLLIDCDLRKPSVH
                                               GKS                 LLIDCDLR     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLLKVDVKTGLVDILADRATTAHVNDVRVIDPLSDMSAFISGDAQFFPAESILDSARFRALLEGCRKAFDVIILDAPPLA
RLLKVDVKTGLVDILADRATTAHVNDVRVIDPLSDMSAFISGDAQFFPAESILDSARFRALLEGCRKAFDVIILDAPPLA
                                                                       IILDAPP  
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
VVSDPLLLAVYADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVAAASGEGSYYPYAAKGRKPGGSA
VVSDPLLLAVYADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVAAASGEGSYYPYAAKGRKPGG  
                                                           YYPY           

© 1998-2019