BYKdb

Annotate results for A0A0K6H6G7

A0A0K6H6G7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K6H6G7
DOMAINtad15/250DEIDLGRLFGLLIDHKWLIAGITTSFAALGVVYALLATPIYQADALLQVEKKSSGMPALG
EMAEMFAQESEAATEIEIMKSRMVVGTVVDQLKLTNVVTPNYMPVIGDFLARRAKEQDRV
LIENLNVSQAELGKALELEIKDKIFTLYDSEGEEVLTGVVGAPAEKGEWFVHIADATTPN
TNSFTLIKKTRLKAITDIQEELDISERGKQTGILSASIQNADGNYAVDVLNAVTNE
DOMAINcd533/726SGPSPGVGKSFVTGNLAAVLAQTGAKVLLIDGDIRRGYLHNMMNAVNDKGLADFLAARDA
TGDLNYKAYTQSGYVDNLDFMPRGTSAPNPAELLMHSRMEQLMEQTANDYDYVLIDTPPI
LAVTDAAIVGRYAGTTLLIARFGMTPAKELVHTVKRFEQNGVEVKGAILNSIERKASSYY
GYGYNYHYGYAYKS
SITEWalker A540/542GKS
SITEWalker A'560/567LLIDGDIR
SITEWalker B645/651VLIDTPP
SITE-598/-644YKAYTQSGYVDNLDFMPRGTSAPNPAELLMHSRMEQLMEQTANDYDY
SITEY Cluster711/724YYGYGYNYHYGYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNSPSPAQQRNDDDEIDLGRLFGLLIDHKWLIAGITTSFAALGVVYALLATPIYQADALLQVEKKSSGMPALGEMAEMF
              DEIDLGRLFGLLIDHKWLIAGITTSFAALGVVYALLATPIYQADALLQVEKKSSGMPALGEMAEMF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQESEAATEIEIMKSRMVVGTVVDQLKLTNVVTPNYMPVIGDFLARRAKEQDRVLIENLNVSQAELGKALELEIKDKIFT
AQESEAATEIEIMKSRMVVGTVVDQLKLTNVVTPNYMPVIGDFLARRAKEQDRVLIENLNVSQAELGKALELEIKDKIFT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYDSEGEEVLTGVVGAPAEKGEWFVHIADATTPNTNSFTLIKKTRLKAITDIQEELDISERGKQTGILSASIQNADGNYA
LYDSEGEEVLTGVVGAPAEKGEWFVHIADATTPNTNSFTLIKKTRLKAITDIQEELDISERGKQTGILSASIQNADGNYA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVLNAVTNEYMLQNIRRNAAEAENSLEFLQRQIPTIKENLNDAEEKLNQYRLESQSVDLTIETEGLLKQLVDLEKQINE
VDVLNAVTNE                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLKEAELSRLYTKQHPSYQALIEQKANLQADRKRLADQIQNLPETQQQVLRYTRDVEVNQEIYLQLLNRMQELNVLKAG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVGNVRILDEAVVKPEPVAPKKPLIVVLATMLGGMLAVGIVFVRAMFNRGVETSEQLEQEGINVYASVPKSDTQENMNEK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVKLAKRKQTDAVRAPLLAKEDPTDLAIESLRGLRTSLHFAMLEARNNIIMISGPSPGVGKSFVTGNLAAVLAQTGAKVL
                                                    SGPSPGVGKSFVTGNLAAVLAQTGAKVL
                                                           GKS                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDGDIRRGYLHNMMNAVNDKGLADFLAARDATGDLNYKAYTQSGYVDNLDFMPRGTSAPNPAELLMHSRMEQLMEQTAN
LIDGDIRRGYLHNMMNAVNDKGLADFLAARDATGDLNYKAYTQSGYVDNLDFMPRGTSAPNPAELLMHSRMEQLMEQTAN
LIDGDIR                                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYDYVLIDTPPILAVTDAAIVGRYAGTTLLIARFGMTPAKELVHTVKRFEQNGVEVKGAILNSIERKASSYYGYGYNYHY
DYDYVLIDTPPILAVTDAAIVGRYAGTTLLIARFGMTPAKELVHTVKRFEQNGVEVKGAILNSIERKASSYYGYGYNYHY
    VLIDTPP                                                           YYGYGYNYHY
       
....:..
GYAYKSQ
GYAYKS 
GYAY   

© 1998-2019