BYKdb

Annotate results for A0A0K6I3C5

A0A0K6I3C5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K6I3C5
DOMAINtad4/176AEIDFRRLFGIVRRQLKLIIATIAIILAIASIALFSITPLYTGTALVLVDPSRKNLLDPS
NSIGSSAADSARVESEVEIVDSDAVLLSVIAEKGLVTDPEFGVKIGLRDKLLAFLRIRDI
TIPTGEEALGSVLAKLKNNVSVSRRGLTYLIAVSVRSENPARAAELANTITTT
DOMAINcd523/712SSAMPGEGKSTLALSLARTLALSGASTLIIDCDFRKPSIQRHLNIEPSNGLVDFLIGDIG
SDELLQNIVRSDPKTSLTAVVGARRADVPTDQLLTREKFSRLIQTARPRFDYIVLDSPPI
EPVVDGLYLAKYADVITFVIRWARTPQRMCVNAIQRLSQTKSEHCRILIALNQQEGKTTF
YNTYSDYYTE
SITEWalker A530/532GKS
SITEWalker A'550/557LIIDCDFR
SITEWalker B635/641IVLDSPP
SITE-650/-654YLAKY
SITE-698/-700GKT
SITE-650/-710YLAKYADVITFVIRWARTPQRMCVNAIQRLSQTKSEHCRILIALNQQEGKTTFYNTYSDY
Y
SITEY Cluster703/710YNTYSDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDAEIDFRRLFGIVRRQLKLIIATIAIILAIASIALFSITPLYTGTALVLVDPSRKNLLDPSNSIGSSAADSARVESEV
   AEIDFRRLFGIVRRQLKLIIATIAIILAIASIALFSITPLYTGTALVLVDPSRKNLLDPSNSIGSSAADSARVESEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIVDSDAVLLSVIAEKGLVTDPEFGVKIGLRDKLLAFLRIRDITIPTGEEALGSVLAKLKNNVSVSRRGLTYLIAVSVRS
EIVDSDAVLLSVIAEKGLVTDPEFGVKIGLRDKLLAFLRIRDITIPTGEEALGSVLAKLKNNVSVSRRGLTYLIAVSVRS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENPARAAELANTITTTYIRLQIESKTSNTREARDIVQRQVADAENAVIAAEKAYDDFILSNVNAIAEQTGRTDLTSMRGR
ENPARAAELANTITTT                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDQLIADRSLAESQAMALRQSVARSDWQSVADNLQTAAVTELNRQRMELERSLAQVEGGSARAINLREELDKINASLQQE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTSALQQLQNSASQYEQEAATLRRDLSSAILNSNLPADMLAQIYRLQQISRNATSQYQMLLARSQTLETEAALQIADSRV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPAYPPNRPSSPKVPLILGVAVLFAIGAGLALAFIFENFVGGFTDEEQVQAVTRLPLATVVPRHNSNVAGMHSISDALV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSPLSMYAESIRRLRATLDNALQSSWVQQPEEARKSGRVIMLSSAMPGEGKSTLALSLARTLALSGASTLIIDCDFRKPS
                                          SSAMPGEGKSTLALSLARTLALSGASTLIIDCDFRKPS
                                                 GKS                 LIIDCDFR   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQRHLNIEPSNGLVDFLIGDIGSDELLQNIVRSDPKTSLTAVVGARRADVPTDQLLTREKFSRLIQTARPRFDYIVLDSP
IQRHLNIEPSNGLVDFLIGDIGSDELLQNIVRSDPKTSLTAVVGARRADVPTDQLLTREKFSRLIQTARPRFDYIVLDSP
                                                                          IVLDSP
       650       660       670       680       690       700       710  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
PIEPVVDGLYLAKYADVITFVIRWARTPQRMCVNAIQRLSQTKSEHCRILIALNQQEGKTTFYNTYSDYYTE
PIEPVVDGLYLAKYADVITFVIRWARTPQRMCVNAIQRLSQTKSEHCRILIALNQQEGKTTFYNTYSDYYTE
P                                                             YNTYSDYY  

© 1998-2019