BYKdb

Annotate results for A0A0K6JDF7

A0A0K6JDF7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K6JDF7
DOMAINcd41/228TSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLENTVGLTSVLLKKSS
MEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGN
KDNFMQNK
SITE-178/-180GKT
SITEWalker A'68/75LLIDADLR
SITEWalker B148/154VIFDTPP
SITE-139/-145YEACAAY
SITEY Cluster215/218YGYY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
                                        TSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
                                               GKS                 LLIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
                                                                   VIFDTPP      
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
                                                      YGYY          
© 1998-2019