BYKdb

Annotate results for A0A0K8J554

A0A0K8J554 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0K8J554
DOMAINtad1/137MELSLKEIIELIYKRLKLIIIFVLIGAGLLFVVNRFIRRPIYTASVQLYVNPNDTTPAAN
LNELNYAQKVVATYVNLLRTQKFYKKVLEETGLNYSESQLKNMTNIQSVGDTEIFKISVN
SHSASDSYELVKAMEYI
DOMAINcd282/468NSPNPEEGKSTTCLNIGIALANAGAKVLLIDCDLRKGRLHKPLNVKSTPGLSNVLSVMKT
DEEVVQDTDYENLQLIACGTIAPNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVAD
ALSLAKLVDGILMVVRENGTTYPNIDSALNKYELIDGKLLGFVINGITFKQGEKSKSKYY
YNVNQDD
SITEWalker A289/291GKS
SITEWalker A'309/316LLIDCDLR
SITEWalker B389/395IILDSAP
SITE-386/-388YDY
SITEY Cluster460/462YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELSLKEIIELIYKRLKLIIIFVLIGAGLLFVVNRFIRRPIYTASVQLYVNPNDTTPAANLNELNYAQKVVATYVNLLRT
MELSLKEIIELIYKRLKLIIIFVLIGAGLLFVVNRFIRRPIYTASVQLYVNPNDTTPAANLNELNYAQKVVATYVNLLRT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKFYKKVLEETGLNYSESQLKNMTNIQSVGDTEIFKISVNSHSASDSYELVKAMEYIAPQIISEVKNNAKITVIDPVVFP
QKFYKKVLEETGLNYSESQLKNMTNIQSVGDTEIFKISVNSHSASDSYELVKAMEYI                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGPSGPNILLNTMIGALAGFFLAFTFAFLWELIDVKVKSKDDLMEKYQIPILGAIPSFNDMIPRKNVLLQKMSFLNRKKK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSNLNQMINEQANFIITEAYKALRINLLYTIRKQGCKKILINSPNPEEGKSTTCLNIGIALANAGAKVLLIDCDLRKGRL
                                         NSPNPEEGKSTTCLNIGIALANAGAKVLLIDCDLRKGRL
                                                GKS                 LLIDCDLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKPLNVKSTPGLSNVLSVMKTDEEVVQDTDYENLQLIACGTIAPNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVA
HKPLNVKSTPGLSNVLSVMKTDEEVVQDTDYENLQLIACGTIAPNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVA
                                                                    IILDSAP     
       410       420       430       440       450       460        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
DALSLAKLVDGILMVVRENGTTYPNIDSALNKYELIDGKLLGFVINGITFKQGEKSKSKYYYNVNQDD
DALSLAKLVDGILMVVRENGTTYPNIDSALNKYELIDGKLLGFVINGITFKQGEKSKSKYYYNVNQDD
                                                           YYY      
© 1998-2019