BYKdb

Annotate results for A0A0K8JA08

A0A0K8JA08 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K8JA08
DOMAINcd41/223TSAGPDEGKSTTAANTAVALAQSGKSVLIVDCDLRKPVQYRIFAKKNRGVTDILIEENIT
AAQLIVDTTIPNLRVLPSGPIPPNPSELLGSQSMTKLLEELKQTADVIIIDAPPAIAVTD
ACVLASKVDGVILVLGAGLVRPDMARKAKELLIKAQGEILGVIMNRVEVEAEHAYYYYYY
GNE
SITE-64/-66GKS
SITEWalker A'68/75LIVDCDLR
SITEWalker B148/154IIIDAPP
SITEY Cluster215/220YYYYYY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQKLVVHEDAKSPIAEAYRTLRTNMQFAKLDGELKVIMFTSAGPDEGKSTTAANTAVALAQSGKSVLIVDCDLRKPVQY
                                        TSAGPDEGKSTTAANTAVALAQSGKSVLIVDCDLRKPVQY
                                               GKS                 LIVDCDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIFAKKNRGVTDILIEENITAAQLIVDTTIPNLRVLPSGPIPPNPSELLGSQSMTKLLEELKQTADVIIIDAPPAIAVTD
RIFAKKNRGVTDILIEENITAAQLIVDTTIPNLRVLPSGPIPPNPSELLGSQSMTKLLEELKQTADVIIIDAPPAIAVTD
                                                                   IIIDAPP      
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
ACVLASKVDGVILVLGAGLVRPDMARKAKELLIKAQGEILGVIMNRVEVEAEHAYYYYYYGNE
ACVLASKVDGVILVLGAGLVRPDMARKAKELLIKAQGEILGVIMNRVEVEAEHAYYYYYYGNE
                                                      YYYYYY   
© 1998-2019