BYKdb

Annotate results for A0A0K8Q3D9

A0A0K8Q3D9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K8Q3D9
DOMAINcd3/191TSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLTDVFNLVPGAGVTDVLSGTAD
LDDVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMKNMLQALAQNATVLIDAPPLLPVTD
AAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGRVLGAVLNYVPTKGTDAYAYHGT
YTSAVAPSV
SITE-140/-142GKT
SITEWalker A'30/37VVVDGDLR
SITEWalker B110/116VLIDAPP
SITEY Cluster177/183YAYHGTY
SITEWalker A10/12GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVTSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLTDVFNLVPGAGVTDVLSGTADLDDVLQPWGALPNLSVLG
  TSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLTDVFNLVPGAGVTDVLSGTADLDDVLQPWGALPNLSVLG
         GKS                 VVVDGDLR                                           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGRIPPNPSELLGSRAMKNMLQALAQNATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGR
SGRIPPNPSELLGSRAMKNMLQALAQNATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGR
                             VLIDAPP                                            
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VLGAVLNYVPTKGTDAYAYHGTYTSAVAPSVLGEDADLLQRDSDASGSWVGENYEVDHAMIEEYVPPRRRVKS
VLGAVLNYVPTKGTDAYAYHGTYTSAVAPSV                                          
                YAYHGTY                                                  
© 1998-2019