BYKdb

Annotate results for A0A0K9F5I0

A0A0K9F5I0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9F5I0
DOMAINcd39/214TSSIPGEGKSTNAANLGVVFAQEGKRVIIIDADMRKPTLHHTFSTINTDGLSDVLTRQKI
YLNVIQKTSVEELSIIPSGPLPPNPVDLLSSKTMEILMQDLRKDYDIIIIDAPPLLSVSD
SQILSNKCDGTILVVNMDLVKKVDVLKAKATLVSSKAQILGVVLNNVKTPKNHYYY
SITEWalker A46/48GKS
SITEWalker A'66/73IIIDADMR
SITEWalker B146/152IIIDAPP
SITEY Cluster212/214YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKLVTDSKSIISEQFRTIRTNIRFSLPDQEIKSLLVTSSIPGEGKSTNAANLGVVFAQEGKRVIIIDADMRKPTLHHT
                                      TSSIPGEGKSTNAANLGVVFAQEGKRVIIIDADMRKPTLHHT
                                             GKS                 IIIDADMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSTINTDGLSDVLTRQKIYLNVIQKTSVEELSIIPSGPLPPNPVDLLSSKTMEILMQDLRKDYDIIIIDAPPLLSVSDSQ
FSTINTDGLSDVLTRQKIYLNVIQKTSVEELSIIPSGPLPPNPVDLLSSKTMEILMQDLRKDYDIIIIDAPPLLSVSDSQ
                                                                 IIIDAPP        
       170       180       190       200       210    
....:....|....:....|....:....|....:....|....:....|....
ILSNKCDGTILVVNMDLVKKVDVLKAKATLVSSKAQILGVVLNNVKTPKNHYYY
ILSNKCDGTILVVNMDLVKKVDVLKAKATLVSSKAQILGVVLNNVKTPKNHYYY
                                                   YYY
© 1998-2019