BYKdb

Annotate results for A0A0K9GHX6

A0A0K9GHX6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9GHX6
DOMAINcd71/250TSSGPSEGKSTTASNTAVVFAQQGKRTLFIDADLRRPTAHYTFACLNTAGLTNVLTKQTT
LEKAVQVVEPLGLHVLTSGPLPPNPAELLSSRSMKELINQVKQDYDVIIIDSPPVTAVTD
AQVLARECQGVILVVSSGRTQIEEAVKTKELLEHTGAKILGAVLNNKKIKGSSYYYYGKK
SITEWalker A78/80GKS
SITEWalker A'98/105LFIDADLR
SITEWalker B178/184IIIDSPP
SITEY Cluster244/247YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRQRQEVYQGQEEVNQLVRKKSKKEIGMGNQRKLVTYSDPKSPVSEQFRTLRTNIQFTAVDEELQTILITSSGPSEGKS
                                                                      TSSGPSEGKS
                                                                             GKS
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTASNTAVVFAQQGKRTLFIDADLRRPTAHYTFACLNTAGLTNVLTKQTTLEKAVQVVEPLGLHVLTSGPLPPNPAELLS
TTASNTAVVFAQQGKRTLFIDADLRRPTAHYTFACLNTAGLTNVLTKQTTLEKAVQVVEPLGLHVLTSGPLPPNPAELLS
                 LFIDADLR                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRSMKELINQVKQDYDVIIIDSPPVTAVTDAQVLARECQGVILVVSSGRTQIEEAVKTKELLEHTGAKILGAVLNNKKIK
SRSMKELINQVKQDYDVIIIDSPPVTAVTDAQVLARECQGVILVVSSGRTQIEEAVKTKELLEHTGAKILGAVLNNKKIK
                 IIIDSPP                                                        
       250
....:....|
GSSYYYYGKK
GSSYYYYGKK
   YYYY   
© 1998-2019