BYKdb

Annotate results for A0A0K9GWN1

A0A0K9GWN1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9GWN1
DOMAINcd53/234TSSSPSEGKSTTVANLAVVFAQQGKNVLLIDGDMRKPTVHYTFNDANTIGLTNVLTKQKE
LVDAIITTDEKNLFVLTSGPVPPNPAELLASNAMKDLMETAKEQFDIVLFDSPPVLAVTD
AQILANFCDGTILVVSSGKTESEAALKSKELLLAANANLLGAVLNNKKSNAGDYYYYYGS
KD
SITE-190/-192GKT
SITEWalker A'80/87LLIDGDMR
SITEWalker B160/166VLFDSPP
SITEY Cluster226/230YYYYY
SITEWalker A60/62GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALKNKKKPVSDSKRKLIAKFNPKSAISEQYRTIRTNIQFSSVDKDIRSIVVTSSSPSEGKSTTVANLAVVFAQQGKNVL
                                                    TSSSPSEGKSTTVANLAVVFAQQGKNVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDGDMRKPTVHYTFNDANTIGLTNVLTKQKELVDAIITTDEKNLFVLTSGPVPPNPAELLASNAMKDLMETAKEQFDIV
LIDGDMRKPTVHYTFNDANTIGLTNVLTKQKELVDAIITTDEKNLFVLTSGPVPPNPAELLASNAMKDLMETAKEQFDIV
LIDGDMR                                                                        V
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
LFDSPPVLAVTDAQILANFCDGTILVVSSGKTESEAALKSKELLLAANANLLGAVLNNKKSNAGDYYYYYGSKD
LFDSPPVLAVTDAQILANFCDGTILVVSSGKTESEAALKSKELLLAANANLLGAVLNNKKSNAGDYYYYYGSKD
LFDSPP                                                           YYYYY    
© 1998-2019