BYKdb

Annotate results for A0A0K9H3A7

A0A0K9H3A7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9H3A7
DOMAINcd56/235TSAGPGEGKSTVAGNLAVAFAQQEKRVLLIDADMRKPTVHYTFNLANYNGLTNVLTKQME
LSQTVNETDIPFLLVLTSGPIPPNPAELLGSKAMDDCLEEACENFDIVIFDTPPLLAVTD
AQILANRCDGTVMVINSEKTEINDALKAKELLQSVQAKIIGTILNNKKMSKSNYYYDSDE
SITEWalker A63/65GKS
SITEWalker A'83/90LLIDADMR
SITEWalker B163/169VIFDTPP
SITEY Cluster229/231YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRLRRKERKKAARGSALRKLIVQTNPKSPISEQYRSIRTSISFSSADQSVRSLMITSAGPGEGKSTVAGNLAVAFAQQEK
                                                       TSAGPGEGKSTVAGNLAVAFAQQEK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLLIDADMRKPTVHYTFNLANYNGLTNVLTKQMELSQTVNETDIPFLLVLTSGPIPPNPAELLGSKAMDDCLEEACENF
RVLLIDADMRKPTVHYTFNLANYNGLTNVLTKQMELSQTVNETDIPFLLVLTSGPIPPNPAELLGSKAMDDCLEEACENF
  LLIDADMR                                                                      
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
DIVIFDTPPLLAVTDAQILANRCDGTVMVINSEKTEINDALKAKELLQSVQAKIIGTILNNKKMSKSNYYYDSDE
DIVIFDTPPLLAVTDAQILANRCDGTVMVINSEKTEINDALKAKELLQSVQAKIIGTILNNKKMSKSNYYYDSDE
  VIFDTPP                                                           YYY    
© 1998-2019