BYKdb

Annotate results for A0A0K9JYB4

A0A0K9JYB4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9JYB4
DOMAINcd142/330TGPIPSAGKSFVAANLAVLLAEIGLRVLLIDGDMRRRHIASFFKQSNPGGLSEVLKGEME
LGDAIRYVGVPGLSFMSCGGYPENPSELLMMPHFRDMMARMSDQFDLVLLDTPPFLVVTD
TAIVASDAGSTVLVLRSGIQTESEIEDTVKKIQRAGGRLVGSVFNAIPRRRSNCRSYGYA
AAYTSTFKS
SITEWalker A149/151GKS
SITEWalker A'169/176LLIDGDMR
SITEWalker B249/255VLLDTPP
SITEY Cluster318/324YGYAAAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIAAGTGLGFFIGTFFIFLRRHAMIGVTDPMFVERRLSVPVLGEVLFSRSQQMLDHEISMSPVSRAPLWFAGKKDERSEP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KALPYHQLQGHDDLTMPHVGGEDARVLASRYPHDPAVEALRAVQTELYLDLVNAPNNIVMPTGPIPSAGKSFVAANLAVL
                                                             TGPIPSAGKSFVAANLAVL
                                                                    GKS         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEIGLRVLLIDGDMRRRHIASFFKQSNPGGLSEVLKGEMELGDAIRYVGVPGLSFMSCGGYPENPSELLMMPHFRDMMA
LAEIGLRVLLIDGDMRRRHIASFFKQSNPGGLSEVLKGEMELGDAIRYVGVPGLSFMSCGGYPENPSELLMMPHFRDMMA
        LLIDGDMR                                                                
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RMSDQFDLVLLDTPPFLVVTDTAIVASDAGSTVLVLRSGIQTESEIEDTVKKIQRAGGRLVGSVFNAIPRRRSNCRSYGY
RMSDQFDLVLLDTPPFLVVTDTAIVASDAGSTVLVLRSGIQTESEIEDTVKKIQRAGGRLVGSVFNAIPRRRSNCRSYGY
        VLLDTPP                                                              YGY
       330  
....:....|..
AAAYTSTFKSVN
AAAYTSTFKS  
AAAY        
© 1998-2019