BYKdb

Annotate results for A0A0K9M7P8

A0A0K9M7P8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0K9M7P8
DOMAINcd51/231TSPGASEGKTITAANLSLMMAKDHKKTVLLDFDLRNPRVHFTFDMPNLYGISSYFSDMCQ
IPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIVDSPPLIVSDA
MVLAREMDGCVMVVDASKTKRDSAIKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYN
A
SITEWalker A58/60GKT
SITEWalker A'78/85VLLDFDLR
SITEWalker B158/164VIVDSPP
SITE-99/-155YGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSY
SITEY Cluster224/229YYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
                                                  TSPGASEGKTITAANLSLMMAKDHKKTVLL
                                                         GKT                 VLL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIV
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIV
DFDLR                                                                        VIV
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAIKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAIKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
DSPP                                                           YYGYGY  
© 1998-2019