BYKdb

Annotate results for A0A0L0MDP3

A0A0L0MDP3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0L0MDP3
DOMAINtad27/286DTMNLPSVFDVALDNKRMIAIVAACFVAVGALYSVLHAPVYRGDLVVQLEDSMSPPVTGP
LNSQTAVPGGDTKSKTDGEIQLLESRTVLSQAVDNTHLFVDAKPHYFPLIGRWIAAHSDG
LSSPGIFGLGGYAWGTESIDVPQFDVPQKMEDDKFYLRVLPGNKYQLDGKDLDKPVEGQV
GKTLKFKTDAGEITLFVAKLEGRPGAEFDLKRQSRLVTIQDLQDQIDVKERGKESDIIGA
SYDGTDPVLVAGVLNEVGRQ
DOMAINcd563/749TSSRASVGKSFVAANSAALLASPNRRVLLVDADIRNGMIHHRLGLKRQYGFADLLESGDV
QRAIQHTSIEYLDFISAGTEGMDADLLLQSPFLEKLLEELSSRYDIVVIDTPPTLEVADS
ASLAPNCASVFLVTLAGVTKMSELEESVKRLRQVGVTPTGSIFNRVTPTFGKYGYGEYGA
NRSTPAK
SITEWalker A570/572GKS
SITEWalker A'590/597LLVDADIR
SITEWalker B669/675VVIDTPP
SITEY Cluster735/740YGYGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRHNQSIRRMNEPEDLYYVQSSEREPDTMNLPSVFDVALDNKRMIAIVAACFVAVGALYSVLHAPVYRGDLVVQLEDSMS
                          DTMNLPSVFDVALDNKRMIAIVAACFVAVGALYSVLHAPVYRGDLVVQLEDSMS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVTGPLNSQTAVPGGDTKSKTDGEIQLLESRTVLSQAVDNTHLFVDAKPHYFPLIGRWIAAHSDGLSSPGIFGLGGYAW
PPVTGPLNSQTAVPGGDTKSKTDGEIQLLESRTVLSQAVDNTHLFVDAKPHYFPLIGRWIAAHSDGLSSPGIFGLGGYAW

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTESIDVPQFDVPQKMEDDKFYLRVLPGNKYQLDGKDLDKPVEGQVGKTLKFKTDAGEITLFVAKLEGRPGAEFDLKRQS
GTESIDVPQFDVPQKMEDDKFYLRVLPGNKYQLDGKDLDKPVEGQVGKTLKFKTDAGEITLFVAKLEGRPGAEFDLKRQS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLVTIQDLQDQIDVKERGKESDIIGASYDGTDPVLVAGVLNEVGRQYLAQNVRRKTEEAQRSIDFLQSQIPLRAESLRRA
RLVTIQDLQDQIDVKERGKESDIIGASYDGTDPVLVAGVLNEVGRQ                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDDYNHTRAQLSSVSLGDEASMLLRQSVDADSQLAALRQKRLELSARYGPNHPDIQALNAQIADLGARSTMLNDRIKVRP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIEQDILRKTRDVQVNQQLYMTLQDNLQEMQLVKAGMAGSARIVDWAPIPEKPIWPRMLIVLPLSALAGLFIGFGAALLR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRLFRGVSDSRDIERTVGLDVYATVPNSVMQKRLEKRMDKTPGATTLLAACSPRDPAIESLRSFRAALQHMVGETVNNRV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFTSSRASVGKSFVAANSAALLASPNRRVLLVDADIRNGMIHHRLGLKRQYGFADLLESGDVQRAIQHTSIEYLDFISAG
  TSSRASVGKSFVAANSAALLASPNRRVLLVDADIRNGMIHHRLGLKRQYGFADLLESGDVQRAIQHTSIEYLDFISAG
         GKS                 LLVDADIR                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEGMDADLLLQSPFLEKLLEELSSRYDIVVIDTPPTLEVADSASLAPNCASVFLVTLAGVTKMSELEESVKRLRQVGVTP
TEGMDADLLLQSPFLEKLLEELSSRYDIVVIDTPPTLEVADSASLAPNCASVFLVTLAGVTKMSELEESVKRLRQVGVTP
                            VVIDTPP                                             
       730       740       750        
....:....|....:....|....:....|....:...
TGSIFNRVTPTFGKYGYGEYGANRSTPAKGARVTPELR
TGSIFNRVTPTFGKYGYGEYGANRSTPAK         
              YGYGEY                  

© 1998-2019