BYKdb

Annotate results for A0A0L1KFN4

A0A0L1KFN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0L1KFN4
DOMAINtad1/140MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVAAELGL
VDRPEFFEMFRFDGADDPAFEIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLSRLVDI
NFTSPDALFSAQVANAWAEN
DOMAINcd483/670TSTRPAEGKSTTSLALATMLARSGKRVILIDGDMRSPSVHHLGNVGHDHGVSNFLAGDDN
YEPSIFHMDDLNLDAMSAGPIPPNAAELLTGTRMRQLIDRLHENYDHVVVDSPPVMGLAD
APLIAGHVDGVIYAVESHGIRSSQVKTALSRLAAVRTRICGAVLTKFEARKAHYGYGYEY
GYGYGRDV
SITEWalker A490/492GKS
SITEWalker A'510/517ILIDGDMR
SITEWalker B590/596VVVDSPP
SITEY Cluster656/666YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVAAELGLVDRPEFFEMFRFDGADDPAF
MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVAAELGLVDRPEFFEMFRFDGADDPAF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLSRLVDINFTSPDALFSAQVANAWAENFIEINLERKVQSTSYGRTAL
EIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLSRLVDINFTSPDALFSAQVANAWAEN                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRQLAEYKDRLDESQRQLVTYASNQEIINLPSQSVGDGSTTQERSIVVDNLAALNAALNEATADRIAAEARFRQAGGSGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAEALSNYAINNLRQKRAELESEYRELMVRFEPGYPQAQSLQSRIDELSRAIEREEARVSASVQAEYQQALAREEALQQR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSALKGDYLDLRRRSIQYNIFQQEVDTNRALYDGLLQRFKEIGVAAGVGVNNVAIVDTAAVPELPSSPRLLLNLAISILA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFGLGAALAFALEQLDEAIADPSEVEHRLGLPLLGSVPKVDDGGTPRDALLDRKSELVDAYIAVQTNLAFTTERGVPRSF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVTSTRPAEGKSTTSLALATMLARSGKRVILIDGDMRSPSVHHLGNVGHDHGVSNFLAGDDNYEPSIFHMDDLNLDAMSA
  TSTRPAEGKSTTSLALATMLARSGKRVILIDGDMRSPSVHHLGNVGHDHGVSNFLAGDDNYEPSIFHMDDLNLDAMSA
         GKS                 ILIDGDMR                                           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPIPPNAAELLTGTRMRQLIDRLHENYDHVVVDSPPVMGLADAPLIAGHVDGVIYAVESHGIRSSQVKTALSRLAAVRTR
GPIPPNAAELLTGTRMRQLIDRLHENYDHVVVDSPPVMGLADAPLIAGHVDGVIYAVESHGIRSSQVKTALSRLAAVRTR
                             VVVDSPP                                            
       650       660       670     
....:....|....:....|....:....|....:
ICGAVLTKFEARKAHYGYGYEYGYGYGRDVETETA
ICGAVLTKFEARKAHYGYGYEYGYGYGRDV     
               YGYGYEYGYGY         
© 1998-2019