BYKdb

Annotate results for A0A0L1LVJ9

A0A0L1LVJ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0L1LVJ9
DOMAINcd60/237TSPSPAEGKSTIAANLAVVFAQQGKRTLFIDSDLRKPTVHYTFHIENHIGLTNILTGQVT
LEEAVKTTRQENLWVLTSGPIPPNPSELLGSKGMDALLEKAKDEFDLVIFDSPPVLAVTD
AQVLSNLTNGVVLVINSGKTKIDDAKKTKELLENAKAKILGVVLNNKKEQANQYYYYE
SITE-197/-199GKT
SITEWalker A'87/94LFIDSDLR
SITEWalker B167/173VIFDSPP
SITEY Cluster233/236YYYY
SITEWalker A67/69GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQEVIQLARKDKEKLFQLRNRSLISLTNPKSSIAEQFRTVRTSIQFSGIEADLQSLLVTSPSPAEGKSTIAANLAVVFA
                                                           TSPSPAEGKSTIAANLAVVFA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQGKRTLFIDSDLRKPTVHYTFHIENHIGLTNILTGQVTLEEAVKTTRQENLWVLTSGPIPPNPSELLGSKGMDALLEKA
QQGKRTLFIDSDLRKPTVHYTFHIENHIGLTNILTGQVTLEEAVKTTRQENLWVLTSGPIPPNPSELLGSKGMDALLEKA
      LFIDSDLR                                                                  
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
KDEFDLVIFDSPPVLAVTDAQVLSNLTNGVVLVINSGKTKIDDAKKTKELLENAKAKILGVVLNNKKEQANQYYYYE
KDEFDLVIFDSPPVLAVTDAQVLSNLTNGVVLVINSGKTKIDDAKKTKELLENAKAKILGVVLNNKKEQANQYYYYE
      VIFDSPP                                                           YYYY 
© 1998-2019